SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000016538 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000016538
Domain Number 1 Region: 34-330
Classification Level Classification E-value
Superfamily L domain-like 5.89e-59
Family Ngr ectodomain-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000016538   Gene: ENSMGAG00000015598   Transcript: ENSMGAT00000017512
Sequence length 519
Comment pep:known_by_projection chromosome:UMD2:24:3412452:3414011:-1 gene:ENSMGAG00000015598 transcript:ENSMGAT00000017512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVGFHLIKQLRGMSVVLVLLPVVLFVVLAGAQRACPKNCRCDGKIVYCESHAFRDIPQNI
SGGSQGLSLRYNSIQKLKSNQFAGLNQLIWLYLDHNYINSVDEDAFQGIRRLKELILSSN
KITHLHNKTFHPVPNLRNLDLSYNKLQVLQSEQFKGLRKLLILHLRSNSLKSVPIRVFQD
CRNLDFLDLGYNRLRSLSRNAFAGLLKLTELHLEHNQFSKINFAHFPRLFNLRSIYLQWN
RIRSISQGLTWTWSSLHNLDLSGNDITGIEPGTFQCLPNLQKLNLDSNKLTNISQETINT
WISLISITLSGNMWECTRSICPLFTWLKNFKGNKESTMICAGPKQIQGEKVSDAVETYNI
CAEIQVVVTERSYQAPKTPQRPVFIPKPTVSKLESNQPTSVVPSPSTDLPTPAVEPEYEH
VSFHKIIAGSVALFLSVAMILLVIYVSWKRYPASMKQLQQHSLMKRRRKKARESERQMNS
PLQEYYVDYKPTNSETMDVSVNGSGPCTYTISGSRECEV
Download sequence
Identical sequences G1NRC8
ENSMGAP00000016538 ENSMGAP00000016538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]