SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017088 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017088
Domain Number 1 Region: 653-933
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.99e-67
Family Protein kinases, catalytic subunit 0.000000000301
Further Details:      
 
Domain Number 2 Region: 29-156
Classification Level Classification E-value
Superfamily L domain-like 9.64e-39
Family L domain 0.00000065
Further Details:      
 
Domain Number 3 Region: 152-271
Classification Level Classification E-value
Superfamily Fibronectin type III 1.52e-31
Family Fibronectin type III 0.0000095
Further Details:      
 
Domain Number 4 Region: 452-592
Classification Level Classification E-value
Superfamily Fibronectin type III 6.98e-22
Family Fibronectin type III 0.0000743
Further Details:      
 
Domain Number 5 Region: 274-352,455-493
Classification Level Classification E-value
Superfamily Fibronectin type III 2.83e-21
Family Fibronectin type III 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017088   Gene: ENSMGAG00000009164   Transcript: ENSMGAT00000018062
Sequence length 1029
Comment pep:known_by_projection chromosome:UMD2:12:16678611:16727325:-1 gene:ENSMGAG00000009164 transcript:ENSMGAT00000018062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKCVEDRDTTQGLQSLSLVKKNNKTVFFLNIDNIASELENFMGLIETVTGYVKIRHSHAL
VSLSFLKNLRYILGEEQVDGNYSFYVLDNHNLQQLWDWNHHNLTIKEGKMYFAFNPKLCV
SEIYRMEEVSGTKGRQSKGDINPRNNGERASCESHILRFVSNTTLKNRIKLTWERYRPPD
YRDLISFTVYYKEAPFKNVTEYDGQDACGSNSWNMVDVDLPPNKENDPGILLQGLKPWTQ
YAIYVKAVTLTMMENHHIHGAKSEIVYIRTNAAVPSIPLDVISASNSSSQLIVKWNPPSL
PNGNLSYYIVRWQQQPQDSYLYRHNYCSKDKVPIRRYADGTIDTEEATEPTKPEGCGGEK
GPCCACPKTEAEKQAEKEEAEYRKVFENFLHNSIFVPSGPDRKRRDVFRIANATLATRNR
NTTGADHFTNVSDAEESEVEYPFFETKVDGKERTVISHLQPFTLYRIDIHSCNHEADTLG
CSASNFVFARTMPSEGADNIPGTVAWEAKEENTVYLKWLEPTNPNGLILMYEIKYGQHGE
EKRECVSRQEYKKLGGAKLTHLNPGNYSARVQATSLAGNGSWTEPVSFYVQPKSANYDNF
LHLIIVLPIAFLLIIGGLLIMLYVFNKKRNSDRLGNGVLYASVNPEYFSASDVYVPDEWE
VPREKITMCRELGQGSFGMVYEGIAKGVVKDEPETRVAIKTVNESASMRERIEFLNEASV
MKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPDTESNPGQAPPTLKKMI
QMAGEIADGMAYLNANKFVHRDLGSRIRKEAEQACKKVKYFGMTRDIYETDYYRKGGKGL
LPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIATLAEQPYQGMTNEQVLRFVMEGGLLEK
PDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKDELDPAFKEVSFFYSEENKPPDTEEL
DLETENMESIPLDPSSTLQPTDKHSGHKAENGPGVVVLRASFEERQPYAHMNGGRKNERA
LPLPQSSAC
Download sequence
Identical sequences G1NS76
ENSMGAP00000017088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]