SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017322 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017322
Domain Number 1 Region: 187-389
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.88e-52
Family DBL homology domain (DH-domain) 0.00000131
Further Details:      
 
Domain Number 2 Region: 2-212
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.5e-35
Family Calponin-homology domain, CH-domain 0.0032
Further Details:      
 
Domain Number 3 Region: 376-538
Classification Level Classification E-value
Superfamily PH domain-like 1.66e-33
Family Pleckstrin-homology domain (PH domain) 0.005
Further Details:      
 
Domain Number 4 Region: 656-757,834-860
Classification Level Classification E-value
Superfamily SH2 domain 2.27e-24
Family SH2 domain 0.00088
Further Details:      
 
Domain Number 5 Region: 782-862
Classification Level Classification E-value
Superfamily SH3-domain 3.53e-20
Family SH3-domain 0.0008
Further Details:      
 
Domain Number 6 Region: 559-649
Classification Level Classification E-value
Superfamily SH3-domain 4.46e-16
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017322   Gene: ENSMGAG00000006722   Transcript: ENSMGAT00000020158
Sequence length 866
Comment pep:known_by_projection chromosome:UMD2:19:7256337:7354566:-1 gene:ENSMGAG00000006722 transcript:ENSMGAT00000020158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLPGSIDLKDIN
FRPQMSQFLCLKNIRTFLKVCHDKFGLRNSDLFDPFDLFDVRDFGKVISAVSRLSFHSIA
QTKGIRPFPSEETTENDDDVYRSLEELADEHDLGDIYDCVPCEDEGDDIYEDIIRVEVQQ
PMKMGMTEDDKRNCCLLEIQETEAKYYKTLEDIEKNYMNPLKLVLTPQDMEAIFINLEDL
IKVHFNFLRAIDVSMMSGGSSLAKVFLEFKERLLIYGKYCSHMEYAQNTLNHLIANRDDV
RQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSSDRPEKQQLKEALEAMQ
DLAMYINEVKRDKETLKKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNHTKQDRYL
FLFDKVVIVCKRKGYNYELKEIIELLFHKMTDDPMNNKDIKKWSYGFYLIHLQGKQGFQF
FCKTEEMKRKWMEQFEMAMSNIKPEKANANHHSFQMYTFEKTTNCKACKMFLRGTFYQGY
LCPKCGAGAHKECLEIIPPCKMGSSADQDLLSAGPGPKMVAVQNYHGNPAPPGKPVLTFQ
IGDVIELLRGDPDSPWWEGRLLQTKKSGYFPSSSVKPCPVDARPPNSRPPSREIDYTVYP
WFAGNMERQQTDNLLKAHVSGTYLIRERPAEAERFAISIKFNEEVKHIKVVEKDNWIHIT
EAKKFESLLELVEYYQNHSLKESFKQLDTTLKYPYKSRERSTSRTFTRSPASCASYNFSF
LSPQGLNFSSQSSSSPFWSVFTPRVIGTAVARYNFAARDMRELSLREGDVVKIYSRIGGD
QGWWKGETNGRVGWFPSTYVEEEGVQ
Download sequence
Identical sequences G3UP34
ENSMGAP00000017322 ENSMGAP00000017322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]