SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017441 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017441
Domain Number 1 Region: 2-227
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.34e-79
Family Calponin-homology domain, CH-domain 0.0000824
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017441   Gene: ENSMGAG00000006582   Transcript: ENSMGAT00000019576
Sequence length 255
Comment pep:known_by_projection chromosome:UMD2:14:9254080:9293209:1 gene:ENSMGAG00000006582 transcript:ENSMGAT00000019576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DAPWKRIQQNTFTRWCNEHLRCVNKRIGNLQHDLSDGLRLIALLEVLSQKRMYRKYHQRP
TFRQMQLENVSVALEFLERESIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPVWED
EGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAPGLCPDWETWD
PSKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKP
KLNPKKVRAYGPGLE
Download sequence
Identical sequences G3UPE6
ENSMGAP00000017441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]