SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017593 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017593
Domain Number 1 Region: 36-204
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.83e-37
Family Calponin-homology domain, CH-domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017593   Gene: ENSMGAG00000010956   Transcript: ENSMGAT00000019560
Sequence length 1621
Comment pep:known_by_projection chromosome:UMD2:1:40472322:40739914:1 gene:ENSMGAG00000010956 transcript:ENSMGAT00000019560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVLGVASKLRQPAVGSKPVHTALPIPNLGPTGTQHYSPKSLELTGAESSMLSCQLTLKS
TCDFGERRALQGKTQELEDSKIYTDWANHYLAKSGHKRLIKDLQQDIADGVLLAEIIQII
ANEKVEDINGCPRSQSQMIENVDVCLSFLAARGVNVQGLSAEEIRNGNLKAILGLFFSLS
RYKQQQHHQQQYYQSLVELQQQVPSSPAEISQSKTQDMQSSLTARYATQSNHSGIATSQK
KASRLPGPSRVPAAGSSTKVQGASNLNRRSQSFNSIDKNKPPQYANGNEKDSPKGPHPSA
GMNGNVQHPTSTGQQQVSAIPSPSASKPWRSKSMNVKHSATSTMLSVKQPSPATSPTPSS
DRLKPPPSEGVKPPSSGQKSMLEKFKLVNARTALRPPLSLSSGPSDSGREDDTFSECGEV
DVLSGGVNSSGSTSSSPKVSPKLTPPKAGSKNLSNKKSLLQPKDKEEKNRDKNKVCTEKT
VKEEKDQVTEASTKKSSKIASLIPKGSKTATAKKESLIPSSSGIPKPGSKVPTAKQSTSS
ACVGSKEAEKLRTTKGNQSQPTPKSQLNEKASPSCGLAFSEGKEPSTALTPGPSTALSGT
ATSSGQSTGNGVVQLPQQQQYSHPNTATVAPFIYRTLSENDSTSLPPADSCTSPTKMDLS
FSKTAKQCLEEISGEDPETRRMRTVKNIADLRQNLEETMSSLRGTQISHSTLETTFDSTV
TTEVNGRSIPSLTSRSTPVTWRLGQASPRLQAGDAPSLGAGYPRSSTSRFIHTDPSRFMY
TTPLRRAAVSRLGNISQIDVSEKGSSDLDMSSEVDAGGYMSDGDILGKSLRTDDINSGYM
TDGGLNLYTRSLNRIPDLATSRDVIQRGVHDVTVDADSWDDSSSVSSGLSDTLDNLSTDD
LNTTSSVSSYSNITASSRKNAHAQTDLEKRSVTDSETWGSTEELKKPEEDFDSNIDSSGK
WKGLPSGLSEESEKGGQKAPLSQTGSWRRGMTTQVGATQSRHKAGTSALKTPGKTDDAKA
SEKVKTPLKGASIQRSPSDAGKSSGDEGKKPPSGIGRSTVTGSFGFKKSGMGSSTIITTS
GATITSGSATLGKMPKSSAIGSKSNAGRKTSLDGSQNQDDGVLHVNSKTTLQYRSLPRPS
KSSGSGIPGRGGHRSSTSSIDSNVSSKSAGAAATKLREPSKIGSGRSSPVTINQTDKEKE
KVAVSDSESVSLSSSPKSSPTSASASGTPGLRQPGSKYPDIASPTFRRLFGAKASGKAAS
APSTEGVKPTSAMPSPSTTLARQGSLESPSSGTGSMGSAGGQSGSSSPLFSKPSDLNADV
VSLSHSLASSPASVHSFTSGALVWAANLSSSSAGSKDTPSYQSMTSLHTSSESIDLPLSH
HGSLSGLTTSTQEVQSLLMRTGSVRSTLSESMHLDRNTLPKKGLRYTPSSRQTSQEEGKE
WLRSHSTGGLQDTGSQSPLVSPSAMSTSATGKYHFSNLVSPTNLSQFNLPGPSMMRSNSI
PAQDTSFDLYDDSQLCGSATSLEERPRAISHSGSFRDSMEEVHGSSLSLVSSTSSLYSTA
EEKAHSEQIQKLRRELVASQEKVATLTSQLSANAHLVAAFEKSLGNMTGRLQSLTMTAEQ
K
Download sequence
Identical sequences G3UPU0
ENSMGAP00000017593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]