SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000018045 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000018045
Domain Number 1 Region: 2-168
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.36e-45
Family Calponin-homology domain, CH-domain 0.0000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000018045   Gene: ENSMGAG00000003985   Transcript: ENSMGAT00000019074
Sequence length 284
Comment pep:known_by_projection scaffold:UMD2:GL424783.1:4549:6143:-1 gene:ENSMGAG00000003985 transcript:ENSMGAT00000019074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLAQKYDPQKEAELRTWIESVTGRQIGADFQKGLKDGVILCELMNKLQPNSVRKINRSAL
NWHQLENLSNFIKAMASYGMNPVDLFEANDLFESGNLTQVQVSLLALAGMAKTKGLQSGV
DIGVKYSERQQRNFDEAKMKAGQCVIGLQMGTNKCASQSGMTAYGTRRHLYDPKNQILPP
MDHSTISLQMGTNKCASQGGMTAPGTRRHIYDAKMGLEKCDNSSMSLQMGSNQGANQSGQ
VFGLGRQIYDPKYCPQGTPGDAANAAGEPGTDPGYHYYQQEESC
Download sequence
Identical sequences H9H2A9
ENSMGAP00000018045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]