SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000018136 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000018136
Domain Number 1 Region: 72-194
Classification Level Classification E-value
Superfamily Spectrin repeat 6.05e-35
Family Spectrin repeat 0.000000549
Further Details:      
 
Domain Number 2 Region: 308-429
Classification Level Classification E-value
Superfamily Spectrin repeat 1.05e-31
Family Spectrin repeat 0.00000345
Further Details:      
 
Domain Number 3 Region: 195-303
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-27
Family Spectrin repeat 0.00000285
Further Details:      
 
Domain Number 4 Region: 537-664
Classification Level Classification E-value
Superfamily EF-hand 1.96e-23
Family EF-hand modules in multidomain proteins 0.076
Further Details:      
 
Domain Number 5 Region: 432-544
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-23
Family Spectrin repeat 0.00000241
Further Details:      
 
Domain Number 6 Region: 4-54
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000000136
Family Calponin-homology domain, CH-domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000018136   Gene: ENSMGAG00000011883   Transcript: ENSMGAT00000020599
Sequence length 692
Comment pep:known_by_projection chromosome:UMD2:5:29265038:29292919:1 gene:ENSMGAG00000011883 transcript:ENSMGAT00000020599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSQDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKA
ETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRAPENTMQAMQQKLED
FRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNAWGGLEQAE
KGYEEWLLNEIRRLERLDHLAEKFRQKASIHESWTDGKEAMLQQKDYETATLSEIKALLK
KHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGALTQKRRE
ALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFK
ATLPDADKERQAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWEHVRQLVPRRD
QALMEEHARQQQNERLRKQFGAQANVIGPWIQTKMEEIGRISIEMHGTLEDQLNHLRQYE
KSIVNYKPKIDQLEGDHQQIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQI
LTRDAKGISQEQMNEFRASFNHFDRKKTGMMDCEDFRACLISMGYNMGEAEFARIMSIVD
PNRMGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDKNYITVDELRRELPPDQAEYC
IARMAPYNGRDAVPGALDYMSFSTALYGESDL
Download sequence
Identical sequences G3UR37
ENSMGAP00000018136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]