SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000019163 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000019163
Domain Number 1 Region: 1-59
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000000697
Family Calponin-homology domain, CH-domain 0.00073
Further Details:      
 
Domain Number 2 Region: 146-174
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000713
Family LIM domain 0.014
Further Details:      
 
Domain Number 3 Region: 116-145
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000119
Family LIM domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000019163   Gene: ENSMGAG00000012490   Transcript: ENSMGAT00000020342
Sequence length 350
Comment pep:known_by_projection chromosome:UMD2:1:50306303:50319062:1 gene:ENSMGAG00000012490 transcript:ENSMGAT00000020342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DFDSLSKDNVYENNRLAFELAERELGIPALLDPNDMVSMKVPDCLSIMTYVSQYYNHFNN
PNQARVPPPMKRPAAAASPPLLAHKKPVAAVESSSEPQDDAPVEPAELSQSQRTMLSSTC
TACQQHVHLVQRYLAEGKLYHRQCFRCKECSSTLLPGSYKPGSEAGTFVCTQHRGKLAMS
GKMDRRPSLDQQSPELRTEAGASSVGEDIHPAGAEVGKDNDSVEETVAETQMPAEVPTNP
EEKDSTPSRAETAIPCAGSGAPISQIPPRPPLPSKPLVPSQDKAGSLDGQHRQTRPTPAP
RRSTDALSPPASHPVPRPRSTIQGEASDSGPGMVNVPEVLQEPRTHRGWP
Download sequence
Identical sequences G3UTS9
ENSMGAP00000019163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]