SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000019182 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000019182
Domain Number 1 Region: 14-249
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.41e-85
Family Calponin-homology domain, CH-domain 0.0000259
Further Details:      
 
Domain Number 2 Region: 267-389
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-34
Family Spectrin repeat 0.000000247
Further Details:      
 
Domain Number 3 Region: 503-624
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-31
Family Spectrin repeat 0.00000084
Further Details:      
 
Domain Number 4 Region: 390-498
Classification Level Classification E-value
Superfamily Spectrin repeat 7.33e-24
Family Spectrin repeat 0.00000107
Further Details:      
 
Domain Number 5 Region: 628-739
Classification Level Classification E-value
Superfamily Spectrin repeat 6.05e-22
Family Spectrin repeat 0.00000089
Further Details:      
 
Domain Number 6 Region: 738-863
Classification Level Classification E-value
Superfamily EF-hand 8.16e-19
Family EF-hand modules in multidomain proteins 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000019182   Gene: ENSMGAG00000011723   Transcript: ENSMGAT00000020733
Sequence length 891
Comment pep:known_by_projection chromosome:UMD2:2:38309279:38402881:-1 gene:ENSMGAG00000011723 transcript:ENSMGAT00000020733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQYTYNYEEDEYMTQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFR
NGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAEEIVDGNV
KMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHLSWKDGLGLC
ALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDVVNTARPDERTIMT
YVSCYYHAFAGAQKAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRTIPWLENR
TPEKTMQAMQKKLEDFRDYRRKHKPPKVQEKCQLEINFNTLQTKLRISNRPAFMPSEGKM
VSDIAGAWQRLEQAEKGYEEWLLNEIRRLERLEHLAEKFRQKASTHEQWAYGKEQILLQK
DYESASLTEVRAMLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAASVNDRCQKIC
DQWDSLGTLTQKRREALERTEKLLETIDQLHLEFAKRAAPFNNWMEGAMEDLQDMFIVHS
IEEIQSLISAHDQFKATLPEADGERQAILSIQNEVEKVIQSYSMRISASNPYSTVTVEEI
RTKWEKVKQLVPQRDQSLQEELARQHANERLRRQFAAQANVIGPWIQTKMEEIARSSIEM
TGPLEDQMNQLKQYEQNIINYKHNIDKLEGDHQLIQEALVFDNKHTNYTMEHIRVGWELL
LTTIARTINEVETQILTRDAKGITQEQMNDFRASFNHFDRDESDNLHSDEFKACLISLGQ
VGNDLQGEAEFARIMSLVDPNGQGTVTFQSFIDFMTRETADTDTAEQVIASFRILASDKP
YILADELRRELPPEQAQYCIKRMPQYTGPGSVPGALDYTSFSSALYGESDL
Download sequence
Identical sequences A0A1D5PNV5 G3UTU7
ENSMGAP00000019182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]