SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000019607 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000019607
Domain Number 1 Region: 20-184
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.83e-39
Family Calponin-homology domain, CH-domain 0.0000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000019607   Gene: ENSMGAG00000017275   Transcript: ENSMGAT00000020732
Sequence length 576
Comment pep:novel chromosome:UMD2:12:20172055:20188990:-1 gene:ENSMGAG00000017275 transcript:ENSMGAT00000020732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FAAVLDNERLTAEEMDERRRQNVAYEYLCHLEEAKRWMEACLNEELPPTTELEEGLRNGV
YLAKLGNFFSPRVVSVKKIYDREQTRYKATGLHFRHTDNVIQWLNAMAEIGLPKIFYPET
TDIYDRKNMPRCIYCIHALSLYLFKLGLAPQIQDLYGKVDFTEEEISNMRLELEKYGIQM
PAFSKIGGILANELSVDEAALHAAVIAINEAIDHQVPADTLVAMKNPNAMLINLDDHLES
TYQDTLYRAKKDKMENAKNRVKNSERERDVYEELLTQAEIQGNINKVNTCAAISKIDLAL
EQGDALALYEALATPALGLRGLLRENCDWYFKQFLSDRQQKQEAGIAGLLQKEDLQLGVD
AANRAAQQYQQRLAAVTRINAAIRMGDADKTVAEMMNPEAQLPEVYEFAANLYQKELATL
QQQSHDGNLTHAELSVAVEMLSSVAVINRALDSGDVSTVWRQLSNPVTGLTNIEDENSQR
YIDDLMKLKAQMHAEENEFITWNDIQSCVDRVNLAVHEEHERILAIGLINEALDEGDTKK
TLQALQIPAAKLEGVTPKVAQHYQDTLLRAKREKAQ
Download sequence
Identical sequences G3UUY6
ENSMGAP00000019607 ENSMGAP00000019607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]