SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000019676 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000019676
Domain Number 1 Region: 7-102
Classification Level Classification E-value
Superfamily L domain-like 2.24e-19
Family Ngr ectodomain-like 0.0011
Further Details:      
 
Domain Number 2 Region: 126-224
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000154
Family I set domains 0.02
Further Details:      
 
Domain Number 3 Region: 241-316
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000237
Family I set domains 0.0000762
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000019676   Gene: ENSMGAG00000008777   Transcript: ENSMGAT00000019192
Sequence length 459
Comment pep:known_by_projection chromosome:UMD2:12:13183190:13303831:1 gene:ENSMGAG00000008777 transcript:ENSMGAT00000019192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HIENWKNLQTLNAVDMELYTGLQRLTIRNSGLRNIQPRAFAKNPHLRYIDLSGNRLTTLS
WQLFQTLRLFDLRLERNPFNCSCDIRWIQLWQEKGEANLQSQELRCMNLDTAVILLQDMN
ITQCDLPEISVSHVNLTVREGENAVITCNGSGSPLPDVDWTVADLHSINTHQTNLNWTNV
HAINLTLVNVTSEDNGFLLTCIAENVVGMSNASVLLTVYYPPRILTLEEPVLHLEHCIAF
AVHGNPAPTLHWLHNGQVLRETEIIHMEFYQQGEVSEGCLLFNKPTHYNNGNYTIVATNQ
LGSANQTIKGHFLEKPFPESTDNFVSIGDYEVSPTPPITVTHKPEEDTFGVSIAVGLAAF
ACVLLVVLFIMINKYGRRSKFGMKGPVAVISGEEDSASSTTSTTASRRLRDAGPDAVVIG
MTRIPVIENPQYFRQGHNCHKPDTCFREIMLNPISLPGH
Download sequence
Identical sequences G3UV13
ENSMGAP00000019676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]