SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000715 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000715
Domain Number 1 Region: 56-565
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.53e-197
Family Myeloperoxidase-like 0.0000000000000317
Further Details:      
 
Domain Number 2 Region: 15-53
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000157
Family EGF-type module 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000715   Gene: ENSMGAG00000001287   Transcript: ENSMGAT00000001361
Sequence length 600
Comment pep:known_by_projection chromosome:UMD2:10:487746:625563:-1 gene:ENSMGAG00000001287 transcript:ENSMGAT00000001361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REGALLTAAFDFVPANPCCSLPCQNRGVCMTTGFDRYECDCTRTGYYGENCTTPEFFTWL
KLTLKPTPNTVHYILTHFKGVWNIINNISFLRDTIMRYVLTSRSHLIDSPPTYNSDYNYK
SWEAYSNLSYYTRSLPPVGHDCPTPMGVKGKKELPDSKLIVEKFLLRRKFIPDPQGTNVM
FTFFAQHFTHQFFKTDHKKGPGFTKAFGHGVDLNHIYGETLERQLKLRLHKDGKLKYQMI
DGEMYPPTVKDTQAEMIYPPHVPEHLQFSVGQEVFGLVPGLMMYATIWLREHNRVCDILK
QEHPEWDDEQLFQTTRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQRFQYQNRI
AAEFNTLYHWHPLLPDTFQIHDQEYTFQQFLYNNSIMLEHGLSHMVKSFSKQSAGRVAGG
KNVPAAVQKVAKASIDQSRQMRYQSLNEYRKRFMLKPFKSFEELTGEKEMAAELEELYGD
IDAMELYPGLLVEKPRPGAIFGETMVEIGAPFSLKGLMGNTICSPEYWKPSTFGGKVGFE
IINTASLQKLICNNVKGCPFTAFHVLNPEPTEATINVSTSNTAMEDINPTLLLKERSAEL
Download sequence
Identical sequences G1MRC2
ENSMGAP00000000715 ENSMGAP00000000715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]