SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001521 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001521
Domain Number 1 Region: 168-246
Classification Level Classification E-value
Superfamily GAS2 domain-like 7.72e-30
Family GAS2 domain 0.00000528
Further Details:      
 
Domain Number 2 Region: 1-147
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.09e-29
Family Calponin-homology domain, CH-domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001521   Gene: ENSMGAG00000002005   Transcript: ENSMGAT00000002183
Sequence length 280
Comment pep:known_by_projection chromosome:UMD2:5:3394585:3484578:-1 gene:ENSMGAG00000002005 transcript:ENSMGAT00000002183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEDLALWLTNLLGREITAETFMEKLDNGALLCRLAETLQEKLKENSFEANKPGKTLPVR
KIPCKANAPSGSFFARDNTANFLSWCRDVGVDDTCLFESEGLVLHKQPREVCLCLLELGR
IAARFGVEPPGLIKLEKEIEQEETLSAPLPSPSPSPTKSPGKKSTGKLLDDAVKHISEDP
PCKCPNKFCVERLSQGRYRVGEKILFIRMLHNKHVMVRVGGGWETFAGYLLKHDPCRMLQ
ISRADGKTSPIQSKSPTLRDMNPDNYLVVSAHYKTKKEIK
Download sequence
Identical sequences G1MT21
ENSMGAP00000001521 ENSMGAP00000001521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]