SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002107 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002107
Domain Number 1 Region: 2-94
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.62e-29
Family Calponin-homology domain, CH-domain 0.0000778
Further Details:      
 
Domain Number 2 Region: 168-196
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000196
Family LIM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002107   Gene: ENSMGAG00000002505   Transcript: ENSMGAT00000002781
Sequence length 821
Comment pep:known_by_projection chromosome:UMD2:16:2599786:2621121:-1 gene:ENSMGAG00000002505 transcript:ENSMGAT00000002781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQCEGYRDVSITNMTTSFRDGLAFCAILHRHRPDLINFNSLSKENVYENNKLAFQVASEQ
LGIPALLDAEDMVALRVPDRLSIITYVSQYYNYFHGRSPIGGMAGIKRSSSELQEQPAGK
KAVPGPPKPVSPKLPPAHPPAKAKPKEASPVTTRCGYCTYSESGNIRSSCCGICGNHVHL
VQRHLVDGKLYHRNCFRCRECWNVLLPGSYKSGPEPGTFICTSHQQPDNVQISGLSSTRN
KPESTPAPTSARAFQKAAEPKKQEQVLKKPSQEGLANSTKPSVSSSGSSGFRSLNTPWSS
SAVNKSEDCKGTPLGNKTDHREGTTSGPLWTTSKTKTQQARENFFQSLESSSNKTSDAKN
HDPSHSSGKISSGRTAAGVTPAKTEKAQARNHIIQALAGTSTSPSKPGGLSSTGSSASSS
SNFSPSSSQSQSPALKAQTSKTGYTTPKQEKTTEPLPKSQTTSKAVESVHKPESKDLKVN
LSSTSSGSSTSLLYYHIIAIYLHLGTVNAGEDKSESPADWRSRLKPVANKDQAGSKKPTD
HSQVGTGSQTQKEKKPTPLVVPSAKQESALLLFGELSFPKERLSSQYAPLLQLNLASSGG
ILKKKLIPSSDLTSFQGWKDYGVSAKKEEEGNHQLNQSTVTFFLHPDYIPEEEIQKKVHD
IEKQLDVLELKGVDLEKQLRGCEGDESEDALMVDWFKLIHEKQLLLRQESELMYKMKQQN
LEEKQWNIEMELRRLVDKPEYLKTRREKEREKELLDSYLNTVNDRNNIVECLDEDRIREK
EEDQMLADMIRKLDGSLETQESEKKKNKFRLSKIWKQKNKS
Download sequence
Identical sequences G1MUC0
ENSMGAP00000002107 ENSMGAP00000002107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]