SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002110 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002110
Domain Number 1 Region: 1-205
Classification Level Classification E-value
Superfamily L domain-like 6.05e-35
Family Internalin LRR domain 0.062
Further Details:      
 
Domain Number 2 Region: 534-643
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.07e-26
Family Calponin-homology domain, CH-domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002110   Gene: ENSMGAG00000002465   Transcript: ENSMGAT00000002784
Sequence length 654
Comment pep:known_by_projection chromosome:UMD2:9:2321735:2344543:-1 gene:ENSMGAG00000002465 transcript:ENSMGAT00000002784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLSKNRFTEIPPDVWLFAPLETLNLYHNCIKSIPESIKNLQMLTYLNISRNLLSTLPKYL
FDLPLKVLVVSNNKLVSIPEEIGKLRDLMELDISCNELQVLPQQIGKLQSLRELNIRRNN
LHMLPDELGDLPLVKLDFSCNKITEIPICYRKLRHLQVIVLDNNPMQIPPAQICLKGKVH
IFKFLSIQACLRIDKKPDSLDLPSLGKRIPSQPLTDSIEDFYPNKNHGPDSGIGSDNGDK
RLSTTEPSDDDTISLHSQVSESTREQTLRNDNHVMGNKLDPQKDQEVYDYIDPNAEEGAV
PEQGDVQIGPLLSYIKERGKHPEKSQKIEHNEDWGDEKVRLQKEQLLAEEDDEIKEVTDL
RKIAAQLLQQEQKHSRLLNHSASVSTRNRPKQPVESEKCVSTDEVNSPVSPYSWQPLENQ
KDSVDDQRWPETQPIIWQNEERRRSKQIRKEYFKYKSSRKSSSGNENDEQDSDNTNVSPQ
SPVSSEDYERTDSNTHGPFGLKPRSAFSRAARQDYGAMDPGFTMRRKMEHLREEREQIRQ
LRNNLESRLKVILPDDIGAALMDGVVLCHLANHIRPRSVASIHVPSPAVPKLSMAKCRRN
VENFLDACKKLGVPQERLCLPHHILEERGLVKVGLTVQALLELPTLKVSQLSAM
Download sequence
Identical sequences G1MUC2
ENSMGAP00000002110 ENSMGAP00000002110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]