SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002629 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002629
Domain Number 1 Region: 239-373
Classification Level Classification E-value
Superfamily TPR-like 0.00000000506
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002629   Gene: ENSMGAG00000002955   Transcript: ENSMGAT00000003310
Sequence length 404
Comment pep:known_by_projection chromosome:UMD2:5:5527828:5556715:1 gene:ENSMGAG00000002955 transcript:ENSMGAT00000003310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPRKPVPVEAGDCAVYTPLLTHGEQVDVLDRLDFVLTNISELRKEVEELRNSLQHLAADI
VGEVRSHLEETQRVTRRRRFPFHRERSDSTGSSSIYFTANSGATNTDDGESEGGYTTANA
ESDYDRESEKESEEGEDELSCETVRTARRDSLDLINEDETHLILDSLLDEGLSQLLQQAD
HLHNGDEQEKREGFQLLLNNKLAYADQGDFLWRLARAHSDMYDITEDTDEKKSYASDGKE
ELEIAFQKWDQSAECHQWYAILCGQLAEHESIQKRIQTGYIFKEHIDKAIALKPEDPKSY
YLLGRWCYQVSHLGWLEKKTASALFETPPTATVQDALQNFLKVEELSPGFSKAVRVYIAK
CYKDLGNNSAALLWMNLASELPVNNKEDSETERELEEMRSVLEE
Download sequence
Identical sequences G1MVG0
ENSMGAP00000002629 ENSMGAP00000002629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]