SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002863 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002863
Domain Number 1 Region: 1467-1606
Classification Level Classification E-value
Superfamily PRC-barrel domain 4.16e-63
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000212
Further Details:      
 
Domain Number 2 Region: 231-340
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000148
Family Calponin-homology domain, CH-domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002863   Gene: ENSMGAG00000003157   Transcript: ENSMGAT00000003551
Sequence length 1611
Comment pep:known_by_projection chromosome:UMD2:8:8544036:8565193:1 gene:ENSMGAG00000003157 transcript:ENSMGAT00000003551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDVDVGAGGESGRRKMDALGDSAVEIVPLELYDSARAKIAANLQWICAKAYGIDNVPEE
LKDPFYIDQYEQEHIKPPVIKLLLSSELYCRVCSLILKGDQVAALQGHQSVIQALSRKGI
YVMEGDDTPVSESDLGCAPIKMSSHMAMIDALMMAYTVEMISIEKVVASVKRFSTFSASK
ELPYDLEDAMVFWINKVNLKMREITEKEIKLKQQLMESPGHQKVRYRRDHLSSRQLPYFP
LLEDLMKDGSDGAALLAVIHYYCPEQMKLDDICLKEVTSIADSLYNIQLLREFSNEYLNK
CFYLTLEDMLYAPLVLKPNIMVFIAELFWWFENVKPDFVQPRDVQEIKDVKTVLQQKSSR
PPVPISNATKRSFMASPASANPADVQPSAQAGSEACSRYYLHPEEPDYLISGKGGSPAFS
PSHPLLPLRQKQQKSLQGEESPGHRHRSNSLTRVDGQPRGSVLAWPEKKPRPLSQPTPFA
LHHSASTDVDPGSGDSISLARSISKDSLASNIVNVTPKNQPHPPSLKTNGKSLLNNVEIE
DEDEELIAIIRSEERPNRGDVELQNAAARVPSIVATAWSPKINSESSESKPDSFYLEPLM
PAVLKPAKEKQIINKEDECGEGKQRSFITKRLNEGHLPLIRKKTSSSHGDHDLSRTFTPI
SSSDFTPVTESGAADSVALVEAGLEASRPLASSSLDPSAQDQPTGGFFLHAAKSDDDIAS
KVNVSYVKSLNLHVPDTTWTMVRQDSDSDLLDIEDTEQDLVVLDDHPIVAKYIGEEESAK
LQEDMKVKEHEDKDDASGRSSPCLSTISQVSSVSMASGSVRMTNFAERKLQRLNSYETKS
STSSSQKTTPDGSESCPAPLTTWKQKREQSPNRPNKDNVNLLASELVQLHMQLEEKRRAI
EAQKKKMEALSARQRLKLGKAAFLHVVKKGKSPDAPQPLKPEHFPKEYPRQNGEDLDEVS
LGSKSEEYFVKEEEREDMLNDSQEVTKVKMQESMAFVEQHKPKDSAAIHELEKSKIISAA
LLEDSVTEVDINECDLSIEKLNETISTLQQAILKISQQQELLMKSPSVPSPGTRSNSQDQ
KVKPSIHFVEPLSPTGMNSLRKPPRFGQGRSPRSGRPADLKVPKDRQQNSARVKTPTQSL
ETLPHLRPFPSNSLSKTPTEIGSENSPDLGSGSQEKCFFDTYRLHDESNQRALVLSTSKD
ANIISEMSKEVNNSFKETGLNSSDGSGKENVPMDEPLRSKANLIEVDLSDLKAPDEGELE
NQDSSADIISEGDQKSGVGFFFKDEQKAEDELAKKRAAFLLKQQRKAEEARLRKQQLEAE
VEQKRDEARRKAEEDRIRKEEEKARRELIKQEYLRKKQQQILEEQGLGKPKSKPKKPRPK
SVHREESYSDSGTKCSSTPDNLSSAQSGSSLSLASAATTEPESVHSGGTPSQRVESMESL
PILSRNPSRNTERDWENASTASSIASVAEYTGPKLFKEPSSKSNKPIIHNAISHCCLAGK
VNEPHKNSILEELEKCDANHYIILFRDAGCQFRALYCYYPDTEEIYKLTGTGPKSITKKM
IDKLYKYSSDRKQFNVIPAKTMSVSVDALTIHNHLWQAKRPAVPKKTQTRK
Download sequence
Identical sequences G1MVZ2
ENSMGAP00000002863 ENSMGAP00000002863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]