SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003014 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003014
Domain Number 1 Region: 17-158
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.72e-41
Family Calponin-homology domain, CH-domain 0.000000344
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003014   Gene: ENSMGAG00000003326   Transcript: ENSMGAT00000003706
Sequence length 200
Comment pep:known_by_projection chromosome:UMD2:26:5534214:5535109:1 gene:ENSMGAG00000003326 transcript:ENSMGAT00000003706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANKGPAYGMSRDVQSKIEKKYDDELEDRLVEWIVAQCGSSVGRPDRGRLGFQVWLKNGI
VLSQLVNSLYPDGSKPVKIPDSPPTMVFKQMEQIAQFLKAAEDYGVVKTDMFQTVDLFEA
KDMAAVQRTLVALGSLAVTKNDGHYHGDPNWFMKKAQEHKREFSESQLKEGKNIIGLQMG
TNKGASQAGMSYGRPRQIIS
Download sequence
Identical sequences G1MWA7 P19966
ENSMGAP00000003014 ENSGALP00000019399 NP_990825.1.86415 XP_003212803.1.16129 XP_015153456.1.86415 XP_015739642.1.68032 ENSMGAP00000003014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]