SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003588 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003588
Domain Number 1 Region: 190-345
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000228
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003588   Gene: ENSMGAG00000003844   Transcript: ENSMGAT00000004292
Sequence length 399
Comment pep:known_by_projection chromosome:UMD2:4:12022612:12076297:-1 gene:ENSMGAG00000003844 transcript:ENSMGAT00000004292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EFGFKGLKSVFLIPSNRNSYKENICIDMLRQGYHKSFSELFTLIHKWNALREAAGPGSAI
WQRQSLEEQPDKLDQLYHFLTRAEAAQRAGRSEEVYDNQLNVAYCFNDSEEKQLRNYFYE
QCFNTAQLIKTDGGKRQAQAHACMGLINEEQGHVVKAAEHYEAFYQLTEGSTWKDETGHT
YNSLACEHLWRIYILQADKMLENKERQQAIKTLIKAIRMAKNGGDKKMEGEAAYCLSLVY
HFAGEEKTALSILNTSIKIFTALCDSAGLRRAYEAIDKILVSQGKVAESLTRLEEFKKVA
ENAHLSQSVVDACVLIGNIYNEGGNYDKAFEYFTQAFEAANTLNNLSLANETRTYCGIAM
AHKLMVAFNSHIEAEDPISLKYLLAWKENRSDMCTDPLT
Download sequence
Identical sequences G1MXK8
ENSMGAP00000003588 ENSMGAP00000003588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]