SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003763 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003763
Domain Number 1 Region: 21-176
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.78e-27
Family Calponin-homology domain, CH-domain 0.0063
Further Details:      
 
Domain Number 2 Region: 197-268
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.01e-26
Family GAS2 domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003763   Gene: ENSMGAG00000004003   Transcript: ENSMGAT00000004470
Sequence length 269
Comment pep:known_by_projection chromosome:UMD2:21:4752898:4755278:1 gene:ENSMGAG00000004003 transcript:ENSMGAT00000004470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SYGTMGTPGAAARSIRPYGSSQQYLYAMKEDLAEWLKEIYGLDIEVGTFLEVLETGAVLC
SHANHITRVAEDFARTCPSAAQHLHLPTIGVSCNSAAQPGTFQARDNISNFIHWCRKEMD
INDVLMFETEDLVLRKNEKNFVLCLLELARRAARFGMCAPTLVQMEEEIEEELRQEMDLP
PADNPLPRPPRKPRDLHNLDQMVQHLVSRCTCPVQFPMIKVSEGKYRVGDSDTLIFVRIL
RQHVMVRVGGGWDTLEHYLDKHDPCRCTS
Download sequence
Identical sequences G1MXY6
ENSMGAP00000003763 ENSMGAP00000003763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]