SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004815 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004815
Domain Number 1 Region: 446-553
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.3e-25
Family Calponin-homology domain, CH-domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004815   Gene: ENSMGAG00000004927   Transcript: ENSMGAT00000005537
Sequence length 1175
Comment pep:known_by_projection chromosome:UMD2:2:8143185:8335397:-1 gene:ENSMGAG00000004927 transcript:ENSMGAT00000005537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQP
GIKNPYRGVVVWPVPENVEITVTLFKDPHAEEFEDKEWTFVIENESPSGRRKALATSSIN
MKQYASPMPTQTDVKLKFKPLSKKVVSATLQFSLSCIFLREGKATDEDMQSLASLMSMKQ
ADIGNLDDFEEDNEEDEENRVNQEEKAAKITEIVNQLNALSSLDEDQDDCIKQANMPSAK
SASSSEELINKLNFLDKEEQDLADSSMNPFGDPDAAELNPFGDPDVEELDSEIASSSKAE
EGFYVDSYNPFKDEDAPEYLNPFDEPDPDPETFVTIRDSPPQPAKRKNVRPVDMSKYLYA
DTSKAEEEELDESNPFYEPKSSPALIKVGPLQEPEKKMKRRAPEPPNLLPKTETNMSENV
SAIPASRELSSSPKPSPIPSPVLGRKPNASQSLLVWCKEVTKNYRGVKITNFTTSWRNGL
SFCAILHHFRPDLINIQHRTLHKKQISVRFRKAYDGFASLGISRLLEPSDMVLLAIPDKL
TVMTYLYQIRAHFCGQELNVVQIEENSSKSTYKVGNYETDTNSSVDQEKFYAELSDLKRQ
PELQAPDGGLADFASQDDSVFVNDSGVGESESEHQTPDDHLSPSTASPSSRRTRSDTDPQ
KSQQSSGRTSASEEVGKCSSTDTAQAQPVVGRKKLLKADTLDLSDLAHVSDQKEDVSPTI
ACEDNDKKRHQSSDNTVGFSEQKRLGHMGSPESVREDPGSRGMKQSLSPTSNLGYFYKDM
DLAKKTCTSPRQAESDSDSDARMTSNHADPAAKAAQQRMLSRQEELKERARVLLEQARRD
AALKAGNKQLTNTIIPARSKQLNDQQDEERRRQLRERARQLIAEARSGVKMSELPSYTEM
AAEKLKERSKASGDEDEDDDNIEIDTNEEVPECSVTGGGDELTNLENDLDSTEQNSKLVD
LKLKKTLETQPQVANSLSSAAQKAVTDSSEQDVKNGTEEHRAERLQKSAERFRNPVVFSK
DSTVRKTQLQSFSQYVESRPEMKRQRSIQEDTKRGNEEKAAITETQRKPSEDEVLNKGFK
DTSQYVVGELAALENEQKQIDTRAALVEKRLRYLMDTGRNTEEEEAMMQEWFMLVNKKNA
LIRRMNQLSLLEKEHDLERRYELLNRELRAMLAIE
Download sequence
Identical sequences G1N0A2
ENSMGAP00000004815 ENSMGAP00000004815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]