SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005176 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005176
Domain Number 1 Region: 485-588
Classification Level Classification E-value
Superfamily TAFH domain-like 4.32e-36
Family TAFH domain-like 0.00000463
Further Details:      
 
Domain Number 2 Region: 765-812
Classification Level Classification E-value
Superfamily Histone-fold 4.19e-17
Family TBP-associated factors, TAFs 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005176   Gene: ENSMGAG00000005271   Transcript: ENSMGAT00000005907
Sequence length 978
Comment pep:known_by_projection chromosome:UMD2:22:8425783:8458298:-1 gene:ENSMGAG00000005271 transcript:ENSMGAT00000005907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGAGGVQGGVINHNTRSQTSALDGATTTSTSTTTAAAGGSEVTAAPGTLSQGKSVVISTM
ATALSTRNGKIGTTTVQTLNGSNVVMNSHHTGSAAFSGTPVTANPASAPAVAPLVNNGPG
SVGKGNTVNAVLPSASNTVIQTSFLNTAVSSASSSSPTVISSQPPPSVGSGGPTVTLVRP
PIHTAGPTVASAGAATQNGSNTVINSTISVTTLVNSQSGSSVPAAPTTQVIKSESPKTIV
QAVSQQQTLATAGQPSTTGGNMIIGQTMQAGLTNVAPNPGGIPPAAPGTPTGMAKGTANT
VAQTLPRTPTATTSGIRATLTPTVLAPRLPQPPQNPTNIQNFQLPPGMVLVRSENGQLLM
IPQQALAQMQAQAHAQSQPQNTMTPRPATPTSAPPVQISTVQAPGTSIIARQVTPTTIIK
QVSQAQTTVQPTTTLQRPPVVQPQIVLGGTAQTTTLGTATAVQTGTPQRTVQGTTATSTA
ATETMENVKKCKNFLSTLIKLASSGKQSSETAANVKELVQNLLDGKIEAEDFTSRLYREL
NSSPQPYLVPFLKRSLPALRQLTPDSAAFIQQSQQQQPTTQATTALTAVMLSPSVQRAAG
KATATVTSTLQQPVISLTQPTQVGVSKQGQSTPLVIQQPQKAGTLIRPPQVTLTQTPMVA
LRQPHSRIMLTTPQQIQLNQLQTVPVVKPTVLPGNKAIATVSTQVAAAQKNKLKEPGGGS
FRDDDDINDVASMAGVNLSEESARILATNSELVGTLTRSCKDETFLFSAPLQRRILEIGK
KHGITEIHPDVVSYVSHATQQRLQNLVEKLSETAQQRNISYKDDERYEQASDVRAQLKFF
EQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLT
ALAAIGPRKKRKVDSPGSGSGTEGSGSSAAVPGSSGVGTTRQFTRQRITRVNLRDLIFCL
ENERETSHSLLLYKAFLK
Download sequence
Identical sequences G1N132
ENSMGAP00000005176 ENSMGAP00000005176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]