SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005324 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005324
Domain Number 1 Region: 586-818,882-1045
Classification Level Classification E-value
Superfamily TPR-like 1.52e-84
Family Tetratricopeptide repeat (TPR) 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005324   Gene: ENSMGAG00000005401   Transcript: ENSMGAT00000006057
Sequence length 1052
Comment pep:known chromosome:UMD2:21:5985802:6032161:-1 gene:ENSMGAG00000005401 transcript:ENSMGAT00000006057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASMELSRALSRSSFQGVFNTLPSVYFFLENMKEVKEPRHRKDNRRPDLEIYKPGLSRLRS
KLVPPKHEASEERSGAEEGKGENGPSGGGSFRRRASSHGELQHGDSHNQNGPSLGNEETE
TKGDLQSQENSCTPLAVDESGAKTTRRIKKPDQQIYQPGKRLHLVAKEVALRLATEEITS
KVEQLRVEGGEETEKGTAEDNNRKTKSIKEDREGNQAGDGVKSSRADKGRRLERTDRVRR
AHDEVMQGKLGATKRYSRSDKRRSRYRTCSTSSAGSNNSVDGAPLVDGMERRQERARIRP
RKQLSASSTDSLDDDRIDEAEAYVSNRISDRKKRLEQSRTSRSESERSSNSREAKGHFRV
TFDSKTMNRDVILADADKKKPLKAFSGCNDSETLDARSQSREPQGRGRGILFLPANTDLS
ASSAASPEPSHPGPRLLLGGAGSKGSRSRGRGGTARRLWDPNPDQKPALKSQTPQLHFLD
TDDEVSPTSWGEARQAQTSYYKFQNSDNPYYYPRAAGQGPQYPYGGYSLQYPMGPSNGVY
PGAFYPGYPGQAGQYMCGPLTPAPLSPEMEQQMRNMQQQELSKLLREAGNQEQQLSNLLS
RDRISPEGLEKMAQLRVEMLQLYERCILTDIEFSDTQNVDQLLWKNAFYQVIEKFRQLLK
DPLGENAQEIRNKLLQLLDEGTSFFDGLLQKLQVSYQFKLEDYMDGMAIRCKPLRKMVKY
ALISAQRCMICQGDICRYREQANDTANYGKARSWYLKAQQIAPKNGRPYNQLALLAIYTR
RKLDAVYYYMRSLAASNPILTAKESLMSLFEETKRKAEQMEQKKHQVLELSPSHRGKGKK
STLRQVGDDATRLEIWIHPSHPRSSQGHESGRDSEQDNGLGNLSPSDLNKRFILSFLHAH
GKLFTRIGMETFPAVAEEVLREFQVLLQHSPPPIGSTRMLQLVAINMFAVYNSQPKECIS
EDCRSVIQEQATALGLSMFALLVRRCTNLLRECMQVPPQEEEQEDEEDDIKISALPQDLK
ELLPSVKVWSDWMLGHPDTWNPPPTSLELPKQ
Download sequence
Identical sequences G1N1E7
ENSMGAP00000005324 ENSMGAP00000005324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]