SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000005342 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000005342
Domain Number 1 Region: 2-268
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.53e-98
Family Capz beta-1 subunit 0.000000000406
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000005342   Gene: ENSMGAG00000005419   Transcript: ENSMGAT00000006075
Sequence length 272
Comment pep:known_by_projection chromosome:UMD2:23:4838497:4876841:-1 gene:ENSMGAG00000005419 transcript:ENSMGAT00000006075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYL
LCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVY
LWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTN
KTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIV
NGLRSVQTFADKSKQEALKNDLVEALKRKQQS
Download sequence
Identical sequences A0A087QKY6 A0A087VAN1 A0A091FSY2 A0A091HDM5 A0A091IM85 A0A091JRF5 A0A091KGD3 A0A091M4Q6 A0A091NK15 A0A091PLV9 A0A091T918 A0A091UGC4 A0A091UYA4 A0A093CTN1 A0A093DYU7 A0A093F6Q1 A0A093J9V6 A0A093RAD5 A0A093SM89 A0A094LBB5 A0A094MQ50 A0A0A0ATL5 G1N1G2 U3J4Q2 U3K7Q6
ENSFALP00000011060 ENSAPLP00000014479 ENSMGAP00000005342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]