SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000006435 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000006435
Domain Number 1 Region: 120-622
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.01e-155
Family Calponin-homology domain, CH-domain 0.00000000425
Further Details:      
 
Domain Number 2 Region: 5-88
Classification Level Classification E-value
Superfamily EF-hand 4.7e-19
Family Calmodulin-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000006435   Gene: ENSMGAG00000006387   Transcript: ENSMGAT00000007188
Sequence length 630
Comment pep:known_by_projection chromosome:UMD2:11:10273575:10294065:1 gene:ENSMGAG00000006387 transcript:ENSMGAT00000007188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENNVTTISREELEELREAFNKIDIDNSGYVSDYELQDLFKEASLPLPGYKVREIIEKIF
TVTDSNKDGKINFEEFVSLIQELKSKDVSKSYRKSINKKLGITALGGTSAISTEGTQHSY
SEEEKVAFVNWINKALQDDPDCKHILPMNPSDASLFKSLADGILLCKMINFSQPDTIDER
AINKKKLTPFTISENLNLALNSASAIGCTVVNIGSQDLQEGKPHLVLGLLWQIIKVGLFA
DIEISRNEALIALLNEGEELDQLMKLSPEELLLRWVNYHLTNAGWQKISNFSQDIRDSRA
YFHLLNQIAPKGGEFDEMHVEIDFSGFNDKNDLRRAEYMLQQADKLGCRQFVTPADVVAG
NPXXXXXXVANLFNTYPALHKPDNSSYDLTLLEGESNEERTFRNWMNSLGVSPYVNHLYS
DLSDALIIFQLYEMTRVPVDWTHVNKRPYPLLGGNMKKIENCNYAVELGKTKAKFSLVGI
AGHDLNEGNPTLTLALIWQLMRRYTLNVLSDLGEGEKVNDEIIIKWVNQTLANANKKTSI
TSFKDKSISTSLPVLDLIDAIAPKAVRQEMVKREDLSYQDKLNNAKYAISVARKIGARIY
ALPDDLVEVKPKMVMTVFACLMGRGLNKIK
Download sequence
Identical sequences G1N3V7
ENSMGAP00000006435 ENSMGAP00000006435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]