SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000007850 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000007850
Domain Number 1 Region: 206-246,342-457
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000047
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000007850   Gene: ENSMGAG00000007687   Transcript: ENSMGAT00000008633
Sequence length 510
Comment pep:known_by_projection chromosome:UMD2:21:8319792:8326666:1 gene:ENSMGAG00000007687 transcript:ENSMGAT00000008633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RHLLHHCFQALMDHGVKVASVLAYSFSRRCSYIAESDSAVKEKAIQIGFVLGGFLSDAGW
YSDAEKVFLSCLQLCTMFSHVEWIRSLYIFERLLHVRNGNCKYHLGEETFKLAQSYMDKL
AKHGQQANKAALYGELCALLFAKSHYDEAYKWCIEAMKEITVGLPVKVVVDVLRQASKAC
VVKREFKKAEQLIKHAVYLAREHFGAKHPKYSDTLLDYGFYLLNVDNICQSVAIYQTALD
IRQSVFGGKNIHVATAHEDLAYSSYVHQYSSGKFDNALFHAERAIGIITHILPEDHLLLA
SSKRVKALILEEIAIDCHNKETEQRLLQEAHDLHLSSLQLAKKAFGEFNVQTAKHYGNLG
RLYQSMRKFKEAEEMHIKAIQIKEQLLGQEDYEVALSVGHLASLYNYDMNQYENAEKLYL
RSIAIGRKKLFGEGYSGLEYDYRGLIKLYNSIGNYEKVFEYHNILANWNRLRDRQFSVTD
ALEDVSSSPQSTEEVVQSFLMSQNVDGQSS
Download sequence
Identical sequences G1N6U3
ENSMGAP00000007850 ENSMGAP00000007850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]