SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008124 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008124
Domain Number 1 Region: 73-581
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.88e-187
Family Myeloperoxidase-like 0.0000000000000983
Further Details:      
 
Domain Number 2 Region: 32-69
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000155
Family EGF-type module 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008124   Gene: ENSMGAG00000007938   Transcript: ENSMGAT00000008913
Sequence length 603
Comment pep:known_by_projection chromosome:UMD2:19:8658026:8661901:1 gene:ENSMGAG00000007938 transcript:ENSMGAT00000008913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHKAPAVPFCCLLLRWAWLCAGQHGPAGVQRINPCCYYPCQHLGVCMRIGLEGYKCDCTR
TGYFGANCTSPELWTRLRDLLKPSPAFYHFVLTHFRWFWDIINSTFIRDTLMRLVLTVRA
KLIPSPPTFNSQYGYISWEAYANVSYYTRILPPVPEECPTPMGTKGKQQLPDAQLLAQRF
LLRHKFEADPRGTNLMFAFFAQHFTHQFFKTSGKMGRGFTKALGHGVDLGHVYGDNLQRQ
HQLRLFQDGKLKFQVVNGEVYPPSVTEAPVHMVYPPAIPKEKQLAMGQEVFGLLPGLCMY
ATLWLREHNRVCDILKQEHPSWGDEQLFQTARLILIGETIKIVIEDYVQHLSGYFLSLKF
DPELLFEQQFQYQNRIAVEFNQLYHWHGLMPDSFTIQGQEYSYEQFLYNTSMLMDYGIEA
LVESFSRQIAGRIGGGQNINANVLGVAVGVIEESRQLRLQPFNEYRKRFGLKPYVSFQEL
TGEEKKAAELEELYGDIDALEFYPGLLLEKPQPNGIFGESMVEIGAPFSLKGLLGNPICS
PEYWKPSTFGGATGFEIVKTASLEKLVCLNVKKCPYVAFRVPDAVAAGETDSSRVGGASS
PEL
Download sequence
Identical sequences G1N7E3
ENSMGAP00000008124 ENSMGAP00000008124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]