SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000008152 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000008152
Domain Number 1 Region: 2-202
Classification Level Classification E-value
Superfamily L domain-like 1.02e-34
Family Ngr ectodomain-like 0.036
Further Details:      
 
Domain Number 2 Region: 567-679
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.93e-29
Family Calponin-homology domain, CH-domain 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000008152
Domain Number - Region: 265-318
Classification Level Classification E-value
Superfamily NEAT domain-like 0.0759
Family NEAT domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000008152   Gene: ENSMGAG00000007957   Transcript: ENSMGAT00000008941
Sequence length 692
Comment pep:known_by_projection chromosome:UMD2:11:15033615:15065167:1 gene:ENSMGAG00000007957 transcript:ENSMGAT00000008941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDLSRNRLSELPAEACHFVSLESLNLYQNCIRYIPEAVLNLQSLTFLNISLKSRNQLSTL
PVHLCSLPLKVLIASNNKLVSIPEEIGQLRQLTELDVSCNEIQTIPPQIGSLESLRDLNV
RRNHLVRLPEELAELPLIRLDFSCNKITTIPVCYRNLRHLQTIMLENNPLQSPPAQICIK
GKIHIFKYLNIEACKIAPDLPDYDRRPMGFGSCHEELYSSRPYGALDSGFNSVDSGDKRW
SGNEPTDEFSDLPLRVAEITKEQRVRRENQYQENRGSTVVTNGGGQVEHDLDQIDYIDSC
ATEEEEEEVRQPKCVDSDSLSSQFMAYIDQRRISNESSPAKPVSAREIQKAEDTRRYLQQ
NRPPADSPYFLSLSSHQSQVPNTDPDLHRRHVERTRREAQLAALQYEEERMRTKQIQREA
VLDFVKQKASLSPQKQSPLDSECPFPSRRSQHTDDSALLVSLSGLNRDSCAAALPNASAL
SPAKSDDRSNISPGSPTTQTVHLSPPHPGHAALPSYRNPSQRPESFLFRAAVRDEANKVI
ASSSSRALPPANDSADTRVRQNSKQREEELELIEQLRKNIESRLKVSLPSDLGAALTDGV
VLCHLANHVRPRSVPSIHVPSPAVPKLTMAKCRRNVENFLEACRRIGVPQEQLCLPLHIL
EEKGLTQVAVTVQALLELAPPKQQQLLHLSAV
Download sequence
Identical sequences G1N7G4
ENSMGAP00000008152 ENSMGAP00000008152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]