SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000009689 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000009689
Domain Number 1 Region: 623-1047
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.1e-113
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.000002
Further Details:      
 
Domain Number 2 Region: 24-290
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 7.85e-76
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.000000879
Further Details:      
 
Domain Number 3 Region: 291-621
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 1.44e-68
Family Lipovitellin-phosvitin complex, superhelical domain 0.000000786
Further Details:      
 
Domain Number 4 Region: 1402-1570
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 9.02e-55
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000564
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000009689   Gene: ENSMGAG00000009357   Transcript: ENSMGAT00000010521
Sequence length 1875
Comment pep:novel chromosome:UMD2:10:19406965:19449617:1 gene:ENSMGAG00000009357 transcript:ENSMGAT00000010521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGLILALVLTLVGNQHLNYQPDFGENKVYTYDHESILLSGIPEKGLARAGIRIRSKVEI
SGIGPKLCIIRIHSTEAEEYNGIWPTSSFSRSLKLTQALTGQLSNPIKFEYSNGHIGNVM
APDSVSDDGLNIYRGILNMLELSMKKMQHSYSLQEAGIGGICNTTYAIQENKKANLVYVT
KSKDLNSCEEKVQVVIGSAYTQPCQTCQQRNKNSRATATYNYKIKYARNEAVITQANVEE
IHQFTPFHEITGGNAMVEARQKLALIDVQKQVAEVPPKEFQKRGSLQYQFGSELLQLPVH
LFKIKDVGSQIEESLQDLVETTYEQLPSDAPAKALKLMHLFRAANEENYESIWKQFSSRP
AYRRYILDVLPAAANHRSLRFLRRKMERQELTNWEMAQTVLMALHSSSPTQDVMEEATLI
VKKHCPRSSSVLGKVCHLSYASLCHKQCSSSDSCSECLQLLHGFAGEALSKSNTEEILLA
LKALGNVGHPASIKHIKKFLPSYAAGASDLPLKVHATAVMSLKSIGTRDPKMVQAITLEI
FLNHKIHPRIRMLAAVVLLETKPGLPILMTLADAVLKDPSMQVASFIYSHLRALGRSTAP
DLQMMACXMAVRALSPKFDRSGYQFSKVFRFSMFKEVLMSGLAAKYLVLNNAGSLIPTMA
VSQLRTHFLGRVADPIEVGIAVEGLQEMFVRGYSPDKDWDTSYDFREILKKLSDWKALPS
DKPFASGYLKMFDQELLFGGIDKNTIQNVLQAWYGPDEKIPSIRRLISSLQSGIGRQWTK
ALLSSEIRRIVPTCIGFPMETSFYYSSVTKVAGNVQAQITPSPRSDFRLTELLNSNIRLR
SKTSLSMAKHMTFVIGINTNMIQAGLEAHIKVNAHVPVNVVATVQMKERSIKAEIPSCKE
ETNLITVSSKTFAVTRNIEDLAASKMTPVLLPEAVPDIMKMSFDSDSASGETDNIRDGQS
VEDPVSSGNSFSFGHSSSWKEQFVQSMCSNASTFGIQVCIEKKSVHAAFIKNVPLYYLIG
EHALRMSFKPVYTDVPIEKIQVTIQAGDQAPTKMVRLVTFEDPETQVSSSKEVIKRVKKI
LDDTDNQATRNSRSSSSSASSISESTESSTSTPSSSDSDDRASQRGTQINLKSRKSKAKE
KKFYPFGDSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSNSKGSSSSSSKA
SGTRQNAKKQSKTTSFPHASAAEGERSVHEQKQKTQSSSSSSRRASSNSRSTSSSSESSG
VSHHQWKQDRQAETKRVKSQFNSHSSYDVSNEWETYLPKVYRLRFRSAHTHWHSGHRTSS
SSSSSSSSEYGSSHSNSSSSDSSSRKSHMSSSSSSSSSSSHHHGEKAAHSSRRSPVSRGA
SAHHRHESSLTHERNFLGDVIPPGITIVAQAVRSDNRNQGYQATAYVRSDAAKVDVQLVV
VQLAETNWKACADAVILPLKAQARMRWGKECRDYRIAALATTGQLARKPAMQLKVQWGNV
PSWIKKTSTVFMQYVPGMALVLGFSEAHQRNPSRELIVRAAATSPRTIDTVIKVPGITLY
YQGLRVPFTLPLGPSSSSYETRDITAWNFLPEIASQIAQEDQSTCEVSEGDFKTFDRMSF
TCSFNKSCNVIVAQDCTEHPKFIVTTRKVDHQSLTREVHINTSSVNITICPAADSSLLVT
CNKESVLSGSEVSEYEKDNIKIYKNGTRVIVEAPTHGLKNVDFDGEILKVTVTSWMRGKT
CGICGNNDREKHNELLMPNHKQAHSCSAFVHSWVLLEETCSGGCKLQRSYVKLNRNPTID
GEESTCYSVDPVLKCMKDCTPIKKTSVKVGFHCFPKDTAVSLLEWQRSSDKKSASEDVVE
SVDSDIDCTCTGDCS
Download sequence
Identical sequences G1NAV2
ENSMGAP00000009689 ENSMGAP00000009689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]