SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010044 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010044
Domain Number 1 Region: 293-607
Classification Level Classification E-value
Superfamily TPR-like 5.94e-111
Family Tetratricopeptide repeat (TPR) 0.0000000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010044   Gene: ENSMGAG00000009710   Transcript: ENSMGAT00000010889
Sequence length 609
Comment pep:known_by_projection chromosome:UMD2:11:17357440:17394736:1 gene:ENSMGAG00000009710 transcript:ENSMGAT00000010889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSMGALQGKGSRAADKAVAMVMKEIPRDEAAEEKPLLTMASQLVNEQQESRPLLSPSIDD
FLCETKPEAVARPVTSNTAVLSTGLDLLDLSEPALQTQNKAKKSENPSRGEGLKTSAHRK
KTDNSDLISVDAEQKVQTVRVSDKSSLDLVDIQTQIEKWDDVNFPGDRSCKVHPSAERTS
SSSSRAQSKELLWSTENRSQSELTNVKSAFDTDSTSELEVAPAIQVRSTKEQRWGGPLLS
RNHSLEEEFERAKAAVESDTEFWDKMQAEWEEMARRNWISENQEAPGQVTISTIEKGYYF
HTENPFKDWPGAFEEGLKKMKEGDLPVTILYLEAAILQEPNDAEAWQFLGITQAENENEQ
AAIVALQRCLELQPNNLKALMALAVSYTNTGHQQEAYQALRNWIKLNPKYKYIVKSKKGS
PALTRRMSKTSDESSLLEEVKDLYLEAAHQNGDMIDPDLQTGLGVLFHLNGEFNRAIDAF
SAALTVRPEDYTLWNRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINLGA
YREAVSNFLTALSLQRKSRNQQQVPHPALSGNIWAALRIALSMMDQPELFQAANVGDLDI
LLRAFNLEP
Download sequence
Identical sequences G1NBM0
ENSMGAP00000010044 ENSMGAP00000010044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]