SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010275 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010275
Domain Number 1 Region: 172-282
Classification Level Classification E-value
Superfamily TPR-like 0.00000000038
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010275   Gene: ENSMGAG00000009930   Transcript: ENSMGAT00000011125
Sequence length 325
Comment pep:novel chromosome:UMD2:11:19124846:19158626:-1 gene:ENSMGAG00000009930 transcript:ENSMGAT00000011125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESESSTDFQKDFLGTSGQNEASQQTQASKESSVAANKLNDIPETLQEVKNHLGDGAVGN
ITERIKEAETEEEKQSNDVGRASPKWKSENNEKQAGKKEATKSQTGNPLTLTPLSHIPLN
ALMRVETELVYADEEEIAFEFAVPAALLGRADATSAATNGAVPNGAVPRLDEKLRAALQE
ASRHYRQKNYAVAAGRFATALELCSKGAAIDKSSKPSPEDISSITSFTETKLAVCYLKLR
KPDLALNHSHRSIILNPAYFRNHLCQAAVFRWLERYSEAARSAMIADYMYWLTGGTEQRI
SKLIKLYWQVKIDGSTRREVPISLL
Download sequence
Identical sequences G1NC47
ENSMGAP00000010275 ENSMGAP00000010275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]