SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010631 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010631
Domain Number 1 Region: 308-416
Classification Level Classification E-value
Superfamily TPR-like 0.0000000806
Family Tetratricopeptide repeat (TPR) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010631   Gene: ENSMGAG00000010250   Transcript: ENSMGAT00000011492
Sequence length 580
Comment pep:known_by_projection chromosome:UMD2:3:52754743:52785511:1 gene:ENSMGAG00000010250 transcript:ENSMGAT00000011492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSFLRREIPTSSSSPGHPQXPLPIEDSELALAGINMLLNNGFRESDQLFKKYRNHSPLMS
FGASFVSFLNAMMTFEEEKMQLACDDLKATEKLCESDEAGVIETIKNKIKKNVDGRKSPL
SMIDRLQRQIIVADCQVYLAVLSFVKQELSAYIKGGWILRKAWKIYNKCYTDINTLQEIY
QKKATQESLTSDAANDNHVAAEGVTEDSLNRLKGAVSFGYGLFHLCISMVPPNLLKIINL
LGFPGDRLQGLSSLMYASESKDMKAPLATLALLWYHTVVRPFFALDGSDNKAGLKEAKEI
LAKKESAYPNSSLFMFFKGRIQRLECQINSALASFHTALELATDQREIQHVCLYEIGWCS
MIEMNFKDAFESFERLKNESRWSQCYYAYLTAVCQGATGDVNGAQNVFKEVQKLFKRKNN
QIEQFSVKKADRFRKQMPTKELCVLASIEVLYLWKALPNCSLSNLQHMSQACQDVDDSSA
VGLRNLLLGAIHKCLGNSEDAVQYFQQAAKDELCRQNNLYIQPYACYELGCLLLDNPQTV
PRGKTLLLQAKEEFTGYDFENRLHVRIHAALASLREVVPQ
Download sequence
Identical sequences G1NCW5
ENSMGAP00000010631 ENSMGAP00000010631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]