SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010892 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010892
Domain Number 1 Region: 387-488
Classification Level Classification E-value
Superfamily TPR-like 0.000000000717
Family Tetratricopeptide repeat (TPR) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010892   Gene: ENSMGAG00000010470   Transcript: ENSMGAT00000011757
Sequence length 660
Comment pep:known_by_projection chromosome:UMD2:10:22048398:22057183:1 gene:ENSMGAG00000010470 transcript:ENSMGAT00000011757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKKYGETADECAEAFFYGKSLLELARMENGVLGNALEGVQVEEEGEKAEDDSALLAVDEE
AREELREQVYNAMGEKEEVKKSSVLTEKEIKGEDVEMEDVTEEKLKEDTVTDTEVKLEGS
EEKTGTSVEKVNSEERDKQTAVEKNTEEAAVEEKAVEKEQNTHEEAEATEGKNSMKEVLD
EEVKAAVEEDEAAEESAEKKGGAGEQTAEATETETAVEKGESIEGQAEVAVEDKAMSQEG
TAEGQAALMAEQKEAAEEQAEAAEKKVEEKESVETAPDQKPDESKEMDSSKEPVSAVGED
PANDTGEKTEVAAKVKKEEKKDDLMEENEGAKVEKEERDDQMEEGEETEESEEEDKENDK
AEDDKENELAVEDKFWSLQESEEEEIGNLELAWDMLELAKVIYKRQETKEAQLHAAQAHL
KLGEVSIESENYVQAIEEFQACLALQQKYLEAHDRLLAESHYQLALAYHYNSQFDEAVQQ
FGKSVEVIDKRMAMLTERIKKAESGSPEDEKEIEELKGLLPEIKEKIEDSKESQKSARVA
ELALKATLVGTTSGFAQSEGSSSVSTIPVRKAADGASQCVTDISHLVRKKRKPEEETHQG
DNEAKKSKAEPAVNGGGGDAAPSGNEVAEKMEEETEKRPQAEPGAAVESTTEKGQEVKSC
Download sequence
Identical sequences G1NDG4
ENSMGAP00000010892 ENSMGAP00000010892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]