SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012859 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012859
Domain Number 1 Region: 214-333
Classification Level Classification E-value
Superfamily TPR-like 5.31e-30
Family Tetratricopeptide repeat (TPR) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012859   Gene: ENSMGAG00000012233   Transcript: ENSMGAT00000013758
Sequence length 424
Comment pep:novel scaffold:UMD2:GL429733.1:1585:19351:-1 gene:ENSMGAG00000012233 transcript:ENSMGAT00000013758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDESKMYLLDQGTTKTYQIPISHLDYKFIEKCTDVQHLEKILRVLRSGEEGCYPDLTLF
CEKRIKHLAPGSRVLRKDKPAATAADFTAEEWETINDELMSWVAEMNEDDNKAQLLKTGT
LHEGQDNLPPIRCSSSCLPAFENEKFQNKQRSKKNIPRDYSEWDKFDVEKECSKIDESSE
ENNSKARFSIRPSLPLIEKKINTTGMTRKEKIFIATREKEKGNEAFASGDYVEAVTYYTR
SISVLPTAAAYNNKAQAEIKLQDWDSALQDCEKVLDMESGNVKALLRRATVYNQLKNYQA
AMKDLNTALCIEPENAVAKKNLLEIEKKLKELKPGSKTEGRGKRIVIQDIEDSAGDEERG
ENAEECGRSSRDKITQMFYLHLHRKTPIHLMKGFNFVLNTNLRNFGVFFELCCLYSLEVH
PSFG
Download sequence
Identical sequences H9H1V5
ENSMGAP00000012859 ENSMGAP00000012859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]