SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012879 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012879
Domain Number 1 Region: 661-875
Classification Level Classification E-value
Superfamily Macro domain-like 5.55e-55
Family Macro domain 0.0000876
Further Details:      
 
Domain Number 2 Region: 1513-1696
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.53e-40
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.03
Further Details:      
 
Domain Number 3 Region: 905-1083
Classification Level Classification E-value
Superfamily Macro domain-like 3.87e-39
Family Macro domain 0.00038
Further Details:      
 
Domain Number 4 Region: 1100-1274
Classification Level Classification E-value
Superfamily Macro domain-like 5.21e-38
Family Macro domain 0.00095
Further Details:      
 
Domain Number 5 Region: 1384-1497
Classification Level Classification E-value
Superfamily WWE domain 3.14e-16
Family WWE domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012879   Gene: ENSMGAG00000012246   Transcript: ENSMGAT00000013778
Sequence length 1697
Comment pep:novel chromosome:UMD2:7:29682437:29699952:-1 gene:ENSMGAG00000012246 transcript:ENSMGAT00000013778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRSMEKTAEQSAETSPSVVLENVEGCTAKCIQILLENVSGLAADDDFTVEMIPELNVAVA
TFLKSIDTQEFINKFAQNKRVKRFKITARLLEVTRSIKVENIPDNISTDYLTVYFENKRN
GGGSVSDIQLFPEENSAIITFCDHKDLSTVLEKQHFLEQTPVSVYPYYHSLGTALYGEER
PVTKMPDSVVMPLDPYVWQFLQRQDRLIEAINQEMANCHCCLKWPQTDCAQPEITLCPSS
SISEQKETMIKLIKTWKQDVSTEFSCIISRYIATKCKVSSAKWKDVKNKWMKDADLIITD
ISEEMVVIAGNRAAVDSAEKEVRECMEKAMEESERKKQTIEISVSITPGNYAVLHNAGLE
ENIHEEYPCLKISYDDTKKTVQLCGLSTEVYKTKANLLEKVLNMPSTSVNVNRNVFLHLC
CVNNKTMSEMLFAANKINAFYELKGDSVMLFGETSKDLSEGEKQLKASLAYKSIDVKDCE
VTKMKEWSDLLAFLRKKYPSSQETVVIHEPVGNENTVIITGFTETVEEVYQNLYDFIDRN
MQVEREIPAKFVAAVEFVEKEKSAVCDELRKKGVTISFHTKTPCISLSGPRAEVSKAASE
LEKIISSLYWKDVSIDKPGAKQFFVDRKDTFVFEAKQKFNCLIRLKEEEQQKSENVDDKE
ENENTLEEQSEEYMEEQQVHSNIGKRYTQMTVQGVLIAVYKADLCTHRVDVVVNASNEDL
KHIGGLAWALLQAAGPELQAECDEVVRKSGRLQAGCAVITGAGKLPCKQVIHAVGPRWKE
QDAEKCMHLLKKTIKMSLQLAETYNHRSIAFPSVSGGIFGFPLHKCVNAIVSAIKKTLEE
FNGGSSLKEIHLVATDEETVQVLSETVQRVFTTKLPTSVPQQGCSTDHWQGESQREKRDG
EKVITTAEGLRIRVEVKDIIDATTDVIVNSVGTDLGFGVGPLCRALLEKAGPELQMEFDK
EKGQQAVGSGSVLCTSGCTLACKFVFHAVLSQWDRGSGQALKTLENIVNSCLMKTEEFGL
NSIAFPAIGTGGFKFPKAVVSKLMFDEAFKFSSSHSRKTLQEVHFLLHPDDTHNIQAFTS
ELKCRVTGNAAPRLADFISPVSTETLGVHKMKIGSITLKVISGDITKEDTEVIVNISNRT
FDATSGVFKAIMDAAGSNVEEECDQYAGQLQSGFITTEGGALSCSKIIHLIHNMNVKNQV
SKVLHECELRSYESVAFPAIGTGAARQSPAKVADDMLDAIVEFASSRSVQHLKEIRIVIF
QKHMLRDFYESMKKREDLNSFEPQSWMSMLKSYFWGQKKSIEKKKLLALKKKVDKVTFQI
CGESKRNVDATESWILDLILKEQFENKIVDELIENFDERQIEALADLQRGKHVTIQLDKS
HSPPCITISGISREVCSVSVEVQKMIKKIMTTQEEQSKAELVYNLVEWRYQRTDGSFVAF
DKLTNMQLEDAKIDKKTHLTIRINKNNYRVDLNTLQALDDQGRTINIQRVPKNEDMQSIE
FPAKWEDMQGERVKLVALAQSCQEYLEVQKRFQKTAHRFVIEKIQRIQNPFLWQTYQIKK
KSLCMKNKNQDNEKLLFHGTAKISLSAINYNGFNRGFAGTNAASIGNGTYFAVNAVYSAQ
DTYSKPDTSGRKYMYLARVLTGEFCVGSRGLVTPPPKHSTDPTDLYDSVVDDVNAPNMFV
IFNDIQAYPEYLITFRQ
Download sequence
Identical sequences G1NI25
ENSMGAP00000012879 ENSMGAP00000012879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]