SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012924 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012924
Domain Number 1 Region: 248-348
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.19e-29
Family Ras-binding domain, RBD 0.00000239
Further Details:      
 
Domain Number 2 Region: 39-140
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.38e-23
Family Ras-binding domain, RBD 0.012
Further Details:      
 
Domain Number 3 Region: 1001-1097
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-22
Family PDZ domain 0.0000287
Further Details:      
 
Domain Number 4 Region: 408-503
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.28e-21
Family FHA domain 0.00000277
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012924   Gene: ENSMGAG00000012282   Transcript: ENSMGAT00000013824
Sequence length 1819
Comment pep:known_by_projection chromosome:UMD2:2:43104052:43181830:-1 gene:ENSMGAG00000012282 transcript:ENSMGAT00000013824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSANRQHKSKLLESDNIHHITAKNSSLNELSRILNDLEFHGVMRFYFQDKAAGNFATKCI
RVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEERRLDVDEKPLVVQLNWNK
DDREGRFVLKNENDTVPPKKAQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKRREKEALRQ
ASDKDDRLLHGDDIENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRS
SDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVIEALEKYGLEKENPKDYCIAR
VILPPGAQHSDDKGAKETILDDDECPLQIFREWPSDKGILVFQLKRRPPDYVPKKSKKIA
DGKPLKGKERVDGSGYGSCLPPEKLPYLVELSPGRRNHFAYYNYHAYEDGSDSRDKPKLY
RLQLSVTEVGTEKFDDNSIQLFGPGIQPHHCDLTNMDGVVTVTPRNIDAETYVEGQRISE
TTMLQSGMKVQFGSSHVFKFVDPTQDHIIPKRPIDASLMVKGPRHKAGAVQETTFDLEGD
VHSGTALPASKSTSRLDGDRTSSASSTAERGMVKPMIRIEQQQDYRRQESRSQDTHGPEL
ILPASIEFRESSEDAFLSAIINYTNSSTVHFKLSPTYVLYMTCRYVLSSQYRPDITPTER
THKVIAIVNKMVNMMEGVIQKQKNIAGALAFWMANASELLNFVKQDRDLSRITVDAQDVL
AHLVQMAFKYLVHCLQSELNNYMPAFLDDPEENNPQRPKIDDVLHTLTGAMSLLRRCRVN
AALTIQLFSQLFHFINMWLFNRLVTAPDSGLCSHYWGAIVRQQLGHIEAWAEKQGLELAA
DCHLSRIVQATTLLTMDKYSHADVPNINSTCFKLNSLQLQALLQNYHCAPDEPLIPTELI
ENVVTVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVRNVPSGLQEFLDPL
CQRGFCRLIPHTRSPGTWTIYFEGADYESHLSHENAELAQPLRKEPEIITVTLKKQNGMG
LSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAAELMT
RTGSVVTLEVAKQGAIYHGLATLLNQPSPMMQRVSDRRGSGKPXGLSLSLNNDVVVTFGA
SLLLELFKAKIILMFNRHVNASFNFPTDQPPSPGGKNAYASGTTTKITSVSTGNLCTEEQ
TLPPRPEAYPIPTQTYTREYFTFPASKSQDRMIRGRWGNFEGAAYEHTFPHHAILQVEKR
VARSQEELRDKVFQPERNRLEVVIRKDIEYIDRKSDSDQWMNSSVDSSTSSQEHLNHTSK
PVSPGSCLTKSGPGRWKTPATSQPTPAAISQPIRTDLPPPPPPPPVHYAAEFDEPQMDLP
LPPPPPPNQVGAQASSQVAAAERKKREEHQRWYEKEKARLEEERERKRREQERKLGQMRS
QPLIPPQPVVPPVSLQQVKSEKTATFQRSQETVIRELQPQQQPRTIERRDLQYITISKEE
LSSSDSLSPDPWKRDAKEKLEKQQQMHIVDMLSKEIQDLQNKPDRTAEENDRLRKLMLEW
QFQKRLQESKQKDEDDDEEEDDDVDTMLIMQRLEAERRARLQDEERRRQQQLEEMRKREA
EDRARQEEERRQQEEERTRREAEEKRRQEEEYYNRLEAERRRQHDEAERRLLEPDEPGLY
RPPLPREYELPSPTPSSNAPPPPPQRNTSYLKTQVLSPDTIYTAKFVAYNDDEEEEDSNL
AAQGINSYTGSSGATVGAHEVYRDPRDKRSKSQDTDLPGAPENLTFRERQRLFSQGQDVS
NKVKASRKLMELENELNTK
Download sequence
Identical sequences G1NI57
ENSMGAP00000012924 ENSMGAP00000012924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]