SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013184 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013184
Domain Number 1 Region: 1-225
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.01e-75
Family Calponin-homology domain, CH-domain 0.000000616
Further Details:      
 
Domain Number 2 Region: 3038-3125
Classification Level Classification E-value
Superfamily RING/U-box 1.41e-20
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 3 Region: 285-393
Classification Level Classification E-value
Superfamily Spectrin repeat 3.96e-20
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 4 Region: 1901-2044
Classification Level Classification E-value
Superfamily Spectrin repeat 5.4e-18
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 5 Region: 2488-2618
Classification Level Classification E-value
Superfamily Spectrin repeat 3.17e-17
Family Spectrin repeat 0.0081
Further Details:      
 
Domain Number 6 Region: 2264-2422
Classification Level Classification E-value
Superfamily Spectrin repeat 2.45e-16
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 7 Region: 1162-1315
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000159
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 8 Region: 2643-2782
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000216
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 9 Region: 1473-1628
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000403
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 10 Region: 956-1101
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000204
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 11 Region: 2966-3057
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000986
Family EF-hand modules in multidomain proteins 0.00054
Further Details:      
 
Domain Number 12 Region: 844-994
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000144
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 13 Region: 2789-2826
Classification Level Classification E-value
Superfamily WW domain 0.000000000297
Family WW domain 0.00021
Further Details:      
 
Domain Number 14 Region: 2062-2170
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000824
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 15 Region: 2827-2886
Classification Level Classification E-value
Superfamily EF-hand 0.00000000231
Family EF-hand modules in multidomain proteins 0.00048
Further Details:      
 
Domain Number 16 Region: 1602-1726
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000448
Family Spectrin repeat 0.0086
Further Details:      
 
Domain Number 17 Region: 727-880
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000606
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 18 Region: 1287-1425
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000245
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 19 Region: 401-459
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000835
Family Spectrin repeat 0.0071
Further Details:      
 
Domain Number 20 Region: 558-621
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000763
Family Spectrin repeat 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013184   Gene: ENSMGAG00000012513   Transcript: ENSMGAT00000014086
Sequence length 3216
Comment pep:novel chromosome:UMD2:2:47182753:47480846:1 gene:ENSMGAG00000012513 transcript:ENSMGAT00000014086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEHNDVQKKTFTKWINARFSKSGTPPVKDMFTDLKDGRKLLDLLEGLTGKPLPKERGSTR
VHALNNVNRVLQVLHQNNVELVNIGGTDIVDGNHKLTLGLLWSIILHWQVKDVMKNIMSD
LQQTNSEKILLSWVRQSSRPYSQVNVLNFTTSWADGLAFNAVIHRHKPEFFSWDKVIMMS
PIERLEHAFSIAKNHLGIEKLLDPEDVAVPLPDKKSIIMYLTSLFEVLPKQVTMEDIREV
ETLPRRFKQECEDGEFGLKQAVAPEEEQNSSRAETPSTVTEVDMDLDSYQVALEEVLTWL
LSAEDAFREQEEISGDVEEVKEQFATHEAFMMELTAHQSSVGSVLQAGNQLVAQGNLSPE
EEFEIQEQMLLLNSRWEELRVESMDRQSRLHDMLMELQKKQLQQLSDWLTVTEERIQKME
SQLLADDLETLQKQLEEHKNLQNDLEAEQVKVNSLTHMVVIVDESQGTDYNCCFDDSMFT
AGVSIGVLCDWSETQMNNLEILIVFFLYFFFSEKILKACVTNACFRLEVSRVWTIVDWYT
NFREKKTVIVTTHELLLILKEDMGMKRQTLDQLNELGQDVAQILGNSRASNQIDHDQEEL
TQRWDSLVQKLEDYSNQVTQAVGSVGMPQISQKTSAETMSLKEKVVVRESRQESPPPPPP
KKRQIPGDSEAKKKFDAESAELLDWISKSKAAIQATDIKEYKKMRETSSVKEKLKVIEKE
KVEKSQKLDDLKRNGHILLDQMGKEGLPAVDLKNLMEKILSGWKEVVQLLEELTRKIKYQ
EDINAYFKEMNELEKIIVEKESWLKNDSSASQPSAVLKDLCQRELTYLVSLSPRLEHLKA
TCKVLTSQPVSPNFVQESLSGFLDRFKLTCQKLDERHQQLKKVTETESLPTQDFLGSLQR
LKDVLSEVECKQQAIASGLSDPSKVEKALQQTKTVCETLEAQKPRVDKLAEETKALEKQS
SDRTKVYMQQFRHVQGHWDKLRLKTSKDVKLLEEITSKLRLFETNSKVVQKWMDGVKGFL
LTEKAAQGDTEGLQRQLDQCTIFVNEMEKIEPSLKEMKDLESVLRSQSIAGINTWAKSRL
VDCQTQWEKLSKQIISQKNRLSESQEKAVNLKKDLAEMQEWMTQAEEEYLEKDFEYKSPE
ELENAVEEMKRAKEDVLQKEVRVKILKDNIKMLATKVPSGGQELATELNVVLENYQLLCN
RIRGKCHTLEEVWSCWIELLQYLDLETAWLNTLEERVQMTENLTDKLDVVNDALESLESV
LRHPADNRTQIRELGQTLIDGGILDDIISEKLEAFNARYEELSHLAVSRQITLEQQLQTM
RETDHMLQVLQENLAELDRQLTSYLTDRVDAFQMPQEAQKIQAEIAAHEATLEELKKSPR
SFPPASPECRSPRGGTLLDVLQRKLREVSTKYQLFQKPANFEQRMLDCKRVLESVKAELH
VLDVKDTDPDVIQTHLDKCMKLYKTLSEVKLEVETVIKTGRQIVQKQQTDNPKGMDEQLT
ALKFLYNDLGAQVTEGKQDLERASQLARKMRKEAASLSEWLATTEAELVQKSTSESLLSD
LDSEIAWAKNVLRELERRKADLKSITESCTTLQALVEGSETSLEEKLCVLNAGWSRVRTW
TEDWCDTLLNHQSQLEIFDENVAHISTWLYQAEALLDEIEKKPASKKEETVKRLTSELDD
VSLRVDNVRDQAVILMNGRGVSCRELVEPKLAELNRNFEKVSQHIKSAKMLVGQERLPVM
PESHEVRVAFPDLEKFESDVQNMLKVVEKHQELSEEDEKLDQERAQIEEVLQRGGQLLQQ
PMEDNKREKIRMQLVLLQTKYNNVQAITVQQRLKSHFATGVRTLPFSAEYLVEINKVLLA
MADVELLLNAPELNTGIYEDFSTQEDALKNVKDILDKLGDQIAVIHEKQPDVILEASGPE
AIQIGDALTQLNAEWDRINRMYNDRKCSFDRAIEAWRQFHCDLNDLSQWITEAEGLLADA
RGPDGSLDLQAAGLHQQELEEGVHSHQSSVLTLNRTGEGIIQKLSATDGSFLQEKIKLEN
VDWHVMFTAKVHVDILFSFLRLKGENQQLIDYRKKLDELRCWLENAENVLDMRFTFNHEE
NLRELQVLSEEMELQGDKLEWLNRTEPEVILDKNVDLQEKNKLSDSLQSLNVRWNKVFRE
VPDRVRQLEAFVRQPYLVAQAKPSDVQKVVLVSSSLEIPVQTQHALELSAPADLDKTTTE
LAEWLVLIDQMLKSNIVTVGNAEDINRTIARMKVTKADLDQRHPQLDSVFTLAQNLKNKT
SSSDIRTVITEKLEKVKNQWDNTQHGVEVRQQQLKYMLSDSIQWDEQRKEMEHLMEQCEI
RLRMLQQAPKEVLVKQISDNKMLIHDLHRGDITVAAFNDLSNKLLREYREDDTRRVKETT
DQMNTCWVNLNQRAVDRQNILETELKTVQTSCKDLESFLKWLQEAETTVNVLADAARREN
TAQDSACVRELRKQMQDIQAEIDAHNDIFKSIDGNRQKMVKALGNSEEAALLQHRLDDMN
QRWNDLKVKSANIRAHLEASAEKWNRLLTSLEELIKWLNTKDEELKKQMPIGGDVPTLQQ
QYDHCKQKALRRELKDKEQTILNAVDQARIFLADQPIEGPEEPRRNVHSKTELTPEEKAM
KIAKAMRKQSSEVKEKWENLNASATIWQKQVDKALEKLKDLQCAMDDLDADLKEAENVRN
GWKPVGDLLIDSLPDHIEKTTAFREEIAPINLKVKTVNDLSSQLSPLDLYPSLKMSRQLD
DLNMRWKLLQVSVEDRLKQLQEAHHDFGPASQHFLSTSVQFPWQRSVSHNKVPYYINHET
QTTCWDHPKMTDLFQSLADLNNVRFSAYRTAIKIRRLQKALCYKQFLYSTSGREGHKLHN
IHNINILSSVQGKQYVSTCTFKKKEKRGMENRLCICNIQICINFCNNCNGWLSSFIDFKK
FLSFYLLVNFLKVGTESSSVPLLGYKFHKSFQELQGKHKVCSRISLASILNDKIAILEMQ
KILPFSALSLFIHIYVYFPQNHNKPEITVKQFIDWMHLEPQSMVWLPVLHRVAAAETAKH
QAKCNICKECPIVGFRYRSLKHFNYDVCQSCFFSGRTAKGHKLHYPMVEYCIPTTSGEDV
RDFTKVLKNKFRSKKYFAKHPRLGYLPVQTVLEGDNLETPITLISMWPEQYDPSQSPQLF
HDDTHSRIEQYATRLAQMERTNGSFLTDSSSTTGSV
Download sequence
Identical sequences G1NIS5
ENSMGAP00000013184 ENSMGAP00000013184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]