SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013738 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013738
Domain Number 1 Region: 213-487
Classification Level Classification E-value
Superfamily TPR-like 2.89e-30
Family Tetratricopeptide repeat (TPR) 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000013738
Domain Number - Region: 150-218
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0275
Family Phosphate binding protein-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013738   Gene: ENSMGAG00000013022   Transcript: ENSMGAT00000014653
Sequence length 505
Comment pep:known_by_projection chromosome:UMD2:5:45340475:45376137:1 gene:ENSMGAG00000013022 transcript:ENSMGAT00000014653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLETEPLFQAWSYFRRRKFRQCSELCSQLLEGAPGEQAAWSLKTRALTEMVYVDEIEMD
QEGIAEMMLDENAIAQVARPGTSLKLPGTSQGGGPSPAVRPVTQSGRPITGFVRPSTQSG
RPSTMEQAIKTPRTALTARPISSASGRYVRLGTASMITNPDGPFINVSRLNLSKYAQKPE
LAKALFEYIFHHENDVKNALDLAALATEHAQFKDWWWKVQIGKCFYRLGLFREAEKQFKS
ALKQQDMVDTILYLAKVYVRLDQPVTAVNLFKQGLERFPGEVTLICGIARIYEEMNDISS
AAEYYKEVLKQDNTHVEAIACIGSNRFYSDQPEIALRFYRRLLQMGVYNYQLFNNLGLCC
FYAQQYDMTLTSFERALFLAENEEETADVWYNLGHVAVGIGDLNLAYQCFKLTLVNNNDY
AEAYNNLAVLEMQKGHIEQARALLQTASYLAPHMYEPHFNFAILSEKIGDFQRSYMAAQK
SEEAFPGHVDTQLLIKQLKERFAML
Download sequence
Identical sequences G1NK27
ENSMGAP00000013738 ENSMGAP00000013738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]