SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014785 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014785
Domain Number 1 Region: 605-746
Classification Level Classification E-value
Superfamily TPR-like 5.06e-24
Family Tetratricopeptide repeat (TPR) 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014785   Gene: ENSMGAG00000013975   Transcript: ENSMGAT00000015725
Sequence length 794
Comment pep:known_by_projection chromosome:UMD2:2:98419973:98463782:1 gene:ENSMGAG00000013975 transcript:ENSMGAT00000015725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEADKEGENSASDAKDARSTLDEEDRGNTTQQKTQEEILFHEETIDLGGDESEGNETVSE
DSNNFIDKLNEQMMESVIISDSPNNSEDDTGELGCLQEIVEQMEAKDNRNTQTEVAKEEL
LSNESETEHEETPKDISEIGTDDQASLKEESIQETEKDEPKLGNNIPVEAKPNGIDESKT
DDQISSPSTSRPSAEAEPIPVCTIFSQASNTNAQPQLFLPDGFEPQMVKSPSFSSIIETP
VKSNPQVVQPSPSLSKFFGDAVNTNTLASDFFDSFTTSNFISVSNPNASSSVPEQMSSLS
NGGESSCAQSNPTFSVGNGRPEGSGPQASLETTQSPKPFSQIQAVFAGSDDPFATALNMS
ELDRRNDAWLPSEETRNVLISVATQQYSTVFIDKENLTMPGLKFDNIQGDAVKDLMLRFL
GEQAAVKRQVLNANSVEQSFVGLKQLISSKNWRAAVDLCGRLLTAHGQGYKKSGLPTNHT
TDSLQLWFVRLALLVKLNLFQNAEMEFEPFGNLDQPDLYYEYYPHVYPGRKGSMVPFSMR
ILHAELPQYLGNPQESLDRLHSMKIICTKILENLEQGLAEDGSMTNITQENRQASVQLWR
SRLGRVMYSMANCLLMMKDYVLAVDAYHTVIKYYPQQEPQMLSGIGRIFLQIGDIKTAEK
YFQDVEKVTHKLDGLQSQIMVLMNRAFLHLGQNNFAEAHRFFTEILRIDSSNAVANNNAA
VCLLYLGKLKDSLRQLEGMVQQDPKHYLHESVLFNLTTMYELESSRSMQKKQALLEAVAV
KEGDSFNTQCLKLG
Download sequence
Identical sequences G1NMH2
ENSMGAP00000014785 ENSMGAP00000014785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]