SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000016993 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000016993
Domain Number 1 Region: 20-68,99-172
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.26e-26
Family Calponin-homology domain, CH-domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000016993   Gene: ENSMGAG00000016054   Transcript: ENSMGAT00000017967
Sequence length 241
Comment pep:known_by_projection chromosome:UMD2:17:11641782:11644665:-1 gene:ENSMGAG00000016054 transcript:ENSMGAT00000017967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADQSNIQSAASKSIRPFRSSEEYLEAMKEDLAEWFNALYDLDMAADTFLEALATGCDLC
QHANNVNRVALEFQQRHPEAAARIPRNEVIFQARNVAPGSFVARDNVSNFIRWCRQDLGI
QDVLMFETNDLVLKKNEKNVILCLLEVARRGSKFGMLAPMLIQMEEEIEEELRDQTCGVL
GAPRGGQVLRPESPAYPGQAQRVSLCDLRNLDELVREILGCCTCPSQFPMVKISEGKYKS
G
Download sequence
Identical sequences G1NS23
ENSMGAP00000016993 ENSMGAP00000016993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]