SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017982 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017982
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.12e-26
Family Calponin-homology domain, CH-domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017982   Gene: ENSMGAG00000016723   Transcript: ENSMGAT00000020695
Sequence length 78
Comment pep:novel chromosome:UMD2:5:29250577:29255329:1 gene:ENSMGAG00000016723 transcript:ENSMGAT00000020695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNK
ALDFIASKGVKLVSIGAE
Download sequence
Identical sequences G3UQP2
ENSMGAP00000017982 ENSMGAP00000017982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]