SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000019284 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000019284
Domain Number 1 Region: 272-592
Classification Level Classification E-value
Superfamily TPR-like 8.34e-120
Family Tetratricopeptide repeat (TPR) 0.000000000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000019284   Gene: ENSMGAG00000014167   Transcript: ENSMGAT00000019716
Sequence length 594
Comment pep:known_by_projection chromosome:UMD2:1:81091977:81102163:1 gene:ENSMGAG00000014167 transcript:ENSMGAT00000019716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSKPLGVASEDELVGEFLQGQNAPLLSHAPQTLRWMTCWLRCKRSNSSFRQAPQRAPGVA
ALALSENWTQEFLAAADAAGDVASDYNEADWSQEFIAEVTDPLSVSPAKWAEEYLEQSEE
KLWLGESEDQSVADKWYEEYQPEDDLKKAASDFLSKVDDPKLNSSEFLKFVRQIGDGRVS
IEANQVTHRDQDQAEQWAAEFMQQQGASDAWVDQFARSGNMSALDTEFEQAKTAVESDVD
FWDKLQAEWEEMAKRDAEAHPWLSDYDDLSSSSYDKGYQFEEDNPMRDHPDAFEEGRKRL
EEGDLPNAVLLFEAAVQQKPDHMEAWQYLGTTQAENEQELLAISALRRCLELQPGNLTAL
MALAVSFTNESLQKQACETLRDWLHHKPAYAHLLEKEPEENVSETNLGTSKRVLGSLLSD
SLFVEVKELFLAAVRSNPSTVDPDVQCGLGVLFNLSGEYEKAVDCFSAALSVRPNDHLLW
NKLGATLANGNRSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALHM
QQKSRGPRGQQGAMSDNIWSTLRMALSMLGQSDLYGAADAHDLPTLLQAFGLQQ
Download sequence
Identical sequences G3UU38
ENSMGAP00000019284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]