SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000019761 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000019761
Domain Number 1 Region: 23-71
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 0.000000000133
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000019761   Gene: ENSMGAG00000009088   Transcript: ENSMGAT00000020617
Sequence length 71
Comment pep:novel chromosome:UMD2:10:17289735:17293707:1 gene:ENSMGAG00000009088 transcript:ENSMGAT00000020617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGLILALVLALVGAQKHDLEPGFRTGKTYVYDYEGLILHGLPGKGLAASGLKLICRLEI
SHVSRSDHLLQ
Download sequence
Identical sequences G3UV87
ENSMGAP00000019761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]