SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ML030916a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML030916a-PA
Domain Number 1 Region: 265-467
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000000654
Family Tropomyosin 0.0014
Further Details:      
 
Domain Number 2 Region: 451-696
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000186
Family Tropomyosin 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ML030916a-PA
Sequence length 974
Comment pep supercontig:GCA_000226015.1:ML0309:149870:169493:-1 gene:ML030916a transcript:ML030916a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYKEQLHMCETNLYETQLRTKDEISKLRDKSDLSKTLEGVIIKLNTKCEDLEGRYNKLTE
ESNFMTTNNKVLQEENDKLHARVTEQSDAMYSRDLAREESRRKIGELSKEVQQIRFELED
AQAENATLKAKQRDYEEALIKSDGSLNYTRECAEEEAEKANRKITELNNLVRDLESERRE
LEISLTAAEDSHDLADKELMKRERMRRNLQGKLSHLVSMLHATLPGIQVTVPRVKLTLND
EGESTDVEYTESTTRSASPHAQLPADEQGVDVESVRQAILALKKQATIHENECRDLKGDL
RKAQDDLEDAESKENKLSRDCKSLTERIQSLEKDKSSYRDQLDSARGSMHALEESLRELQ
GQLDDLEHQKNETAHQNQLLEREITGLKGKLAEEEDELSEMRKMRDNAHGEIDSLVTKYD
MLKKHKDQVESERHSLERQLKDVVDEKAVLESRLESIHQTLERSEKEKSDLQANVAKLQK
TCHATQDKITSLESTLSSLEKKLKSHKEENSELRTKLSAVNTEASNLRRDKDLLDEKINN
MTADMQAVSHKLIDQQDKITKLQTAATDNEMSRIKAEGQIRSANLALQQRSSELRTQSNK
VELLTTENKHLQGTVSSLTGKVNSLEREKRELNECVLSLQTEKKLNLQSRASHEKQILSL
QEALKEREDSVRNYESKMNSSEMQAEKNKRELKKLEYLLGETEVGSKDRIQRLEEKYKSE
LDRERKLVQDKDRIVTLEQERSEGLRKKINELQDQIAQLNVTVHRQEATKKSYQDRIENK
TAENKDLRSLLNETYNLQDEPATRLSYNDTPERLNTRSPDVRNRSPERSVMSPEKGSGYR
TSPIRRRRSISPIRRTHYESSTPVRRRTSPIRYRSPTRNGSPSPSRTWRYRDSPYKANVM
SEEVKKDLSNITERTEDRSSSSHHSDHGRSANQDRERVTRDQSSTNQDVTSGLEVDNKEL
KCLRCRSPIGLTLA
Download sequence
Identical sequences ML030916a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]