SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ML05292a-PA from Mnemiopsis leidyi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ML05292a-PA
Domain Number 1 Region: 84-178
Classification Level Classification E-value
Superfamily PDZ domain-like 4.47e-30
Family PDZ domain 0.0093
Further Details:      
 
Domain Number 2 Region: 4-60
Classification Level Classification E-value
Superfamily L27 domain 4.71e-21
Family L27 domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ML05292a-PA
Sequence length 194
Comment pep supercontig:GCA_000226015.1:ML0529:8056:10488:1 gene:ML05292a transcript:ML05292a-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLTLERDIRRAIELMETLEQSGEIPASKLAAMKNVLKSDFCRAVREVYEQVHETVDIN
HPPEIRAEAAAKATVAAFAASEGHAHPRVIELPKTEEGLGFNVMGGKEQASPIYISRIIP
GGAAHKDGNLRRGDQLLSVNGQSVEKASHETAVDLLKNAQGKVRLVVKYTPKVLEEMESR
FERQKASRRGRAPQ
Download sequence
Identical sequences ML05292a-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]