SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000101 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000101
Domain Number 1 Region: 280-511
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 3.53e-88
Family Mammalian PLC 0.000000586
Further Details:      
 
Domain Number 2 Region: 130-279
Classification Level Classification E-value
Superfamily EF-hand 1.33e-37
Family EF-hand modules in multidomain proteins 0.00055
Further Details:      
 
Domain Number 3 Region: 645-720
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.29e-16
Family PLC-like (P variant) 0.00072
Further Details:      
 
Domain Number 4 Region: 5-115
Classification Level Classification E-value
Superfamily PH domain-like 8.89e-16
Family Pleckstrin-homology domain (PH domain) 0.00026
Further Details:      
 
Domain Number 5 Region: 584-617
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 0.00000115
Family Mammalian PLC 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000101   Gene: ENSMGAG00000000712   Transcript: ENSMGAT00000000732
Sequence length 723
Comment pep:novel chromosome:UMD2:29:666227:672563:-1 gene:ENSMGAG00000000712 transcript:ENSMGAT00000000732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLSEDEDLQLMLQGSLLLKVTSRRAKERRYRLQEDGITVVSERRFGRMASKHSFSVAHIV
SVHRGHHSEGLRRYGCAIPEWNCFTITFEGGRRNLDLGARDEDVALRWVRGLRTLRHPRA
SHGQPGDIHSWIHGMLQRADKDKDNRMCFQEVQIMLRMANIHMDNAYAHQLFKECDHSGD
GRLEDQELEDFCRRLLRRPEEELFGHYSGEDCVLSAEELRDFLQDQGEEGTLHQACAIIC
AHELNEKARQQGLMTLDGFTMYLLSAAGDILNQEHTEVHQDMSQPLCHYFISSSHNTYLT
RNQIGGTSSTEAYVRALMMGCRCVELDCWEGPDGEPIVCHGHTFTSKILFRDVIEAIRDC
AFKRSPYPVILSLENHCGVEQQATMARHMKAILGDMLLTQPLEGQDPGVLPSPEQLKGKV
LVKGKKLPELQCETCSVTSIPDEEEEEETEEEDRLQAKDASHVAPELSAMVVYCQATPFP
GLAQALQQPRPYEMSSFSERKARKLIKEAGKGSGMGTVGQGQRMLRTGWNGGSGGKDQVW
GWDEVQVLWSIGIQTQGRGLKFGDRFWDQVLRSVAPCGPHPTQLSHSGPTFVHYTSRQLS
RVYPLGLKMTSSNYNPTSQPDPIMVSVPPSSSQPAPSIPHSLGNDRFNPRWEETLTFQLR
VPELALVRFVVEDHDSTSCNDFVGQFTLPLGSMREGYRHIHLLSKDGASLAPATLFVHVT
CKR
Download sequence
Identical sequences G1MPY0
ENSMGAP00000000101 ENSMGAP00000000101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]