SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000248 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000248
Domain Number 1 Region: 1-90
Classification Level Classification E-value
Superfamily EF-hand 0.0000000048
Family Calmodulin-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000248   Gene: ENSMGAG00000000862   Transcript: ENSMGAT00000000882
Sequence length 295
Comment pep:novel chromosome:UMD2:13:177210:210417:1 gene:ENSMGAG00000000862 transcript:ENSMGAT00000000882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDGKLSLEEFQAFFSDGTLNEEELENLFHTIDSDNTNNVDTKELCDYFANHMGDYEDVLA
SLETLNLSILKAMDYTKRVYESGSNMDQFVTRFLLKETANQTQSLLSSVESAVDAIDEQT
NPCRQCPGPAGLTLTESWYDSPVPSFAPPGRMVPRGHGKSSQSGAPKPRQDGLEGQIGRL
AALIGRLEDKVGTVLARHRPGHLARVPKALLKLHVPIDEGIEASHRGSVTPSRDRQRFAK
LFQGRRVWDNDFSWEKHLQSATCKGFQHVKVDALSQPEAISSVAVPAAWCTLSQD
Download sequence
Identical sequences G1MQA3
ENSMGAP00000000248 ENSMGAP00000000248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]