SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000479 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000479
Domain Number 1 Region: 24-581
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.41e-138
Family Myeloperoxidase-like 0.000013
Further Details:      
 
Domain Number 2 Region: 795-938
Classification Level Classification E-value
Superfamily EF-hand 1.78e-29
Family Calmodulin-like 0.01
Further Details:      
 
Domain Number 3 Region: 1276-1376
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.84e-17
Family Ferredoxin reductase FAD-binding domain-like 0.0081
Further Details:      
 
Domain Number 4 Region: 1386-1467,1494-1547
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 3.76e-16
Family Flavohemoglobin, C-terminal domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000479   Gene: ENSMGAG00000000994   Transcript: ENSMGAT00000001119
Sequence length 1554
Comment pep:novel chromosome:UMD2:12:321715:338046:1 gene:ENSMGAG00000000994 transcript:ENSMGAT00000001119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NGNTLSIHYFAAHHVGSSLSGAQNISWEVQRYDGWYNNLQHHSRGSVGSRLLRLLPANYA
DGVYQALQEPHVPNARQLSNAVARGPSGLPSQRNTTVLAVFFGFHVLSDILGTEKPGCPA
EFLNIHIPEGDPVFDPAGTGDIVLPFQRIRWALETGQSPNSPREQTNEVTGWLDGSSIYG
PSHSWSDALRNFSNGQLAAGPGGYVPRETDGKVPMWKALDPSTGQGGPHGIYDLGNAWGN
ENRFLQAISIAWFRYHNYLAAELANDHPSWSDEDIFQHARKRVIATFQSIVLYEWLPALL
GTPVQTYTGYQQHLDPSLSPEFVAVARMFLATMVPPGVYKRDPSCHLRNTSSSSDPLPAV
RLCNSYWSRESTEMQQEDVDDLLLGMSSQIAEQEDSIVVEDLQDYWYGPLKYSRTDYVAS
WLQRGRDLGLPTYNQARERFGLEPLQDWTNFAPHSQQKVLALEVAALYANNTARLELLPG
GMLEGDSPLFSAIILDQFVRLRDGDRFWFENTRNGLFTEKEAEEIRNTTFRDVLAAVTYS
QQAELQSNVFVWSEGDPCPQPQQLTAQLLANCTPMTVLDYFEGSGAGFGIIIIVLCCLPL
VSLFVAWIIATLRKRDFKKLQKKKKASVRREVTGEAIHAMEWHGPKTDSSLVYIQLQADK
VLKVLDGRGLVLRSVNLKAQQRVEVILSSNKGNKALLLKSPKEYDLVLLFSEEAERSSFL
GKLQDFLKTSCLELHVSEMKEQSLLKRAVTQEQRKQILETFFRHLFAQMLDINKTDAGEL
NFESSQKAKESLTCELSRAEFAEALGLKANSMFVDSMFSLADKDGNGYISFREFLDILVV
FMKGSSEEKSKLMFRMYDIDENGFLSKEEFLRMLRSFIEISNNCLSREQAEQVTESMFQA
SGFQDRHELTWEDFHYMLRDHDNELRLTQLCIKGVPEVFKQNVHNRVSFIKKEPRGTISD
GEDPNQGMVAHCMDREGHELKKRPGRKRCQRGSSPHCCVTGKYFHKRANQYQLHLYTEAQ
RKKYQQNKVQQKIQEFKRFIENYRRHIVCVVLFSAITAGLFVERAYYYAFASPSTGIAQT
TFVGIIISRGSAACISFLYSYILLTTMCRNLITVLRETFLNCYIPFDAAVDFHRWIALAA
LIFSVLHTAGHIVNVYIFSVMPLSVLSCLFSSIFMNDGSQLPQKYYWWFFQTIPGMTGVL
LLIILAVMYIFATHHFRRVSFQAFWITHHLYMLLYVLVIIHGSYALVQQPRFHIYFIIPA
LIYGADKLLSLSRKKVEISVVKAELLPSGVTHLRFQRPQDFDYKSGQWVRIACMALGTTE
YHPFTLTSAPHEDTLSLHIRAVGPWTTRLRELYSPESLAVIGKLPKLYLDGPFGEGHQEW
HKFEVSVLVGGGIGVTPFASILKDLVFKSSINSKLMCKKIYFIWVTRTQRQFEWLADIIR
EVEETDRNELVSVHIYITQLAEKFDLRTTMLYICERHFQKVLNKSLFTGLRSITHFGRPP
FVPFFDSLQEVHPEVHKIGVFSCGPPGMTKSVEKACQQLNKKDQAYFAHHYENF
Download sequence
Identical sequences G1MQU6
ENSMGAP00000000479 ENSMGAP00000000479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]