SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000614 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000614
Domain Number 1 Region: 8-151
Classification Level Classification E-value
Superfamily EF-hand 1.66e-41
Family Calmodulin-like 0.000000552
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000614   Gene: ENSMGAG00000001184   Transcript: ENSMGAT00000001258
Sequence length 163
Comment pep:known scaffold:UMD2:GL427306.1:37:5155:1 gene:ENSMGAG00000001184 transcript:ENSMGAT00000001258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEM
IDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIM
LQATGETITEDDIEELMKDGDKNNDGRIDYDGRSLSCLKFGCE
Download sequence
Identical sequences H9H068
ENSMGAP00000000614 ENSMGAP00000000614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]