SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000000625 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000000625
Domain Number 1 Region: 2-91
Classification Level Classification E-value
Superfamily EF-hand 5.59e-18
Family S100 proteins 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000000625   Gene: ENSMGAG00000016679   Transcript: ENSMGAT00000001269
Sequence length 248
Comment pep:novel scaffold:UMD2:GL424174.1:71638:72490:1 gene:ENSMGAG00000016679 transcript:ENSMGAT00000001269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQLQENINGIITTFYTYASSDGDCSTLSRGELRQLIEQEFEDVIMDARDPRTVEKVLLF
LDEDSSGKVDFSEFLNLVFRVAKACHGQLQQYLEPEDDQELTVQEEADGEQHHKQVLEEG
VSEQVREGGTSQQDQDTQQHQKGEEPKKHQDTQQNQEDGTPKNQDTQKTEKSETPKIQDT
QKTQEVETPKSNQGTQQKQKSEMPKNVHQDDRAKAREEGPKRGENVVTETSEKDRNTQKI
EKIPKHDP
Download sequence
Identical sequences H9H070
ENSMGAP00000000625 ENSMGAP00000000625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]